DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: oys and Mboat2

Sequence 1:NP_001286265.1 Gene:oys FlyBaseID:FBgn0033476 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001101486.2 Gene:Mboat2 RGDID:1305798 Length:519 Species:Rattus norvegicus

Alignment Length:480 Identity:201/481 (42%)
Similarity:274/481 (57%) Gaps:18/481 (4%)


  Fly    15 GSRTFTWLADMVGLSVDLVNFLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCF 79
            ||.....|::.|.|.:|.|||::||:.||..|..||:.||.||.||.:||..|..:||...:|||
  Rat     8 GSTLLQPLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCF 72

  Fly    80 GQQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMR-QLYDYGSYALDITGPLMII 143
            |..|:|......|.|.::.......:.:...:.|:.||....:.| .::|||.|:.|.:||:|||
  Rat    73 GWYALHFLVQSGISYCIMIIAGVESMHQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMII 137

  Fly   144 TQKVTSLAFSIHDGFVRGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFV 208
            |||:||||:.||||..|.|||||.:|:..|:|:|||.|||.||..:|..||||||..|||||.|:
  Rat   138 TQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIAFI 202

  Fly   209 EGYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKI---YPVKDMKEDD 270
            ||  ..|....:|.....::....||||..||..|:   |||....:..:.|   .||:...::.
  Rat   203 EG--RASHMAQSGENGKEEQHGKAEPSPNAAVTEKL---LVCGLSLLFHLTISSMLPVEYNIDEH 262

  Fly   271 FMNNTSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSF 335
            |....|...|..|..::....|.|||.||.|||||.|.:|.||.||||:|.::||||||:.:...
  Rat   263 FQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARWDLISNLRIQQI 327

  Fly   336 EFSTNMRDAINNWNCGTNRWLRTLVYERV---PQQYGTLLTFALSAVWHGFYPGYYLTFATGAVV 397
            |.||:.:..::|||..|..||:.:.|||.   |    |:.||.|||:|||.||||||||.||.::
  Rat   328 EMSTSFKMFLDNWNIQTALWLKRVCYERATFSP----TVQTFFLSAIWHGVYPGYYLTFLTGVLM 388

  Fly   398 VTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLLEFMGSIKLYLRFYLCLHI 462
            ..|||..|..|||.|......::||||:|...|::.:.|...|||||....|...|..:|.||||
  Rat   389 TLAARAVRNNFRHYFVEPPQLKLFYDIITWAATQITISYTVVPFVLLSINPSFTFYRSWYYCLHI 453

  Fly   463 ISLVTIFILPKFIRGERRLRTSNGN 487
            .|::.:.:||  ::...|.:.:..|
  Rat   454 CSILVLLLLP--VKKSPRKKNTEEN 476

Known Domains:


GeneSequenceDomainRegion External IDIdentity
oysNP_001286265.1 MBOAT 22..484 CDD:294479 198/469 (42%)
Mboat2NP_001101486.2 MBOAT 13..474 CDD:294479 198/472 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63965067
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H6971
Inparanoid 1 1.050 367 1.000 Inparanoid score I2055
OMA 1 1.010
OrthoDB 1 1.010 D881262at2759
OrthoFinder 1 1.000 FOG0001111
OrthoInspector 1 1.000 T618089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13906
Phylome 1 0.910 0.833 Consistency score
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.