DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TER94 and smid

Sequence 1:NP_001097249.1 Gene:TER94 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_523959.2 Gene:smid FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster

Alignment Length:926 Identity:288/927 (31%)
Similarity:429/927 (46%) Gaps:250/927 (27%)


  Fly     9 DFMRGYHSEQDEKMKPK--------DSFDKREDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQ 65
            :.|...:|:..:.:.||        .|.|:.||.:..              :..|.|.  |:.:.
  Fly    97 NMMNSLYSQPRKPLAPKPISEPIDISSGDENEDDSNT--------------KTTNGDG--VAAAA 145

  Fly    66 AKMDELQLFRGDTVILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDV 130
            |........:|..:    ||..|.|         |:..:...:|.:.| .:|:|...::|....|
  Fly   146 APPPPTPAVQGSAL----KRLMEEV---------PEIAVAAKKVAKPN-TIHVSSSEAIQKLHQV 196

  Fly   131 KYGKRVRIL-----PIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLT 190
             .|.|.:.|     |..:....|.|             .|:.:|...:   |..:|  :||..|.
  Fly   197 -VGNRAKNLSEDAVPRSKDHRNVPG-------------LYQQLHQNQS---RDRLR--KFKRDLE 242

  Fly   191 DPEPYCIVAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAI 255
            ...|                      .||     :.||||....|.::.||: :.::.|..:..:
  Fly   243 VQHP----------------------TES-----FRDIGGMDSTLKELCEML-IHIKSPEFYFQL 279

  Fly   256 GVKPPRGILMYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSP 320
            |:.|.||:|::||||.|||.:|||::.:.......|...|::..::||||..:|:.|::|...||
  Fly   280 GLLPSRGLLLHGPPGCGKTFLARAISGQLKMPLMEIPATELIGGISGESEERIREVFDQAIGYSP 344

  Fly   321 AIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKS---SHLIVMAATNRPNSIDPALRRF 382
            .::||||||||...|.....::||||||||::.:|.:|.:   ..::|:|||.||:.:||.|||.
  Fly   345 CVLFIDEIDAIGGNRQWASKDMERRIVSQLISSLDNLKANEFGQSVVVIAATTRPDVLDPGLRRI 409

  Fly   383 GRFDREIDIGIPDATGRLEVLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAA------ 441
            ||||.||.|.||....|.|:|||..:.:.:...::.::||..:.|:|||||.:|.|.||      
  Fly   410 GRFDHEIAIHIPSRKERREILRIQCEGLSVDPKLNYDKIAELTPGYVGADLMALVSRAASVAVKR 474

  Fly   442 --LQQIRE-------KMDLIDLEDD---------------------------KIDAE-------- 462
              :::.||       .|..:.|:||                           |:|.:        
  Fly   475 RSMKKFRELHAASEKNMTTVTLDDDEPSEDAGETPVPDSKGEETAKDAEAEQKVDGDKETSAKDK 539

  Fly   463 ----------------------------------------------------------------- 462
                                                                             
  Fly   540 SEGDSPNIETPKKATNGNSSIKSPQKTPKKSAEKPTDAAMDVDNVAPEEPKKAVEQEVDSSSSND 604

  Fly   463 -----VLASL----------------AVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLES 506
                 .||.|                .:|:.:|..|:....|||.||..:.||:|||.|||.||.
  Fly   605 EYYEPTLAELTNFLDNPPEEFADPNFCLTLIDFVDAIKVMQPSAKREGFITVPDTTWDDIGALEK 669

  Fly   507 VKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLT 571
            :::||:..|..||::|:...:.|:....|||..|||||||||||||||||...||||||||||:.
  Fly   670 IREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGINFISVKGPELMN 734

  Fly   572 MWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAK 636
            |:.||||..||..|.:||::||||:||||.||:...|... ||...:..|::||:||||||:..:
  Fly   735 MYVGESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDG-GDGNNSGTRIVNQLLTEMDGVEER 798

  Fly   637 KNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKA---NLRKSPLAKEVDLTYIA 698
            |.|:|:.|||||||||||||||||||.::|:..|:...|..||||   |.::..||.:|||..||
  Fly   799 KGVYILAATNRPDIIDPAILRPGRLDTILYVGFPEQSERTEILKATTKNGKRPVLADDVDLDEIA 863

  Fly   699 KVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDDPVPEITSAHFEEAM 763
            ..|:|::||||..:.::|...::||::              |:. |.:.||..  :.|.||:||:
  Fly   864 AQTEGYTGADLAGLVKQASMFSLRQSL--------------NNG-DTNLDDLC--VRSQHFQEAL 911

  Fly   764 KFARRSVSDNDIRKYE 779
            :..|.||::.|.:.|:
  Fly   912 QQLRPSVNEQDRKIYD 927

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 280/881 (32%)
CDC48_N 47..129 CDD:280513 15/82 (18%)
CDC48_2 153..213 CDD:215011 8/60 (13%)
AAA 263..392 CDD:278434 59/132 (45%)
AAA 536..669 CDD:278434 84/133 (63%)
Vps4_C <741..783 CDD:286426 13/40 (33%)
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 239/666 (36%)
AAA 287..418 CDD:278434 58/131 (44%)
P-loop_NTPase 679..>716 CDD:304359 20/37 (54%)
AAA 699..830 CDD:278434 84/132 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86002325
eggNOG 1 0.900 E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D169540at33208
OrthoFinder 1 1.000 FOG0000162
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23077
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.