DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TER94 and vcp

Sequence 1:NP_001097249.1 Gene:TER94 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_958889.1 Gene:vcp ZFINID:ZDB-GENE-030131-5408 Length:806 Species:Danio rerio

Alignment Length:800 Identity:663/800 (83%)
Similarity:738/800 (92%) Gaps:6/800 (1%)


  Fly    30 KREDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVL 94
            |.:||:|||||:|:|||||||:|:.|:|||||||||||||||||||||||:||||:|:|||||||
Zfish     8 KNDDLSTAILKQKNRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRRETVCIVL 72

  Fly    95 SDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNLFEIYLKP 159
            |||||.|||:||||||||||.|.|.||:|:|.|||||||||:.:||||::.||:||||||:||||
Zfish    73 SDDTCSDEKVRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKP 137

  Fly   160 YFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVG 224
            |||||||||..||.|:||..||.:|||||.|||.|||||||:|||.|:|:|||||:||||||.||
Zfish   138 YFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVG 202

  Fly   225 YDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGAFFF 289
            ||||||.||||||||||||||||||:||||||||||||||:||||||||||||||||||||||||
Zfish   203 YDDIGGVRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFF 267

  Fly   290 LINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLM 354
            |||||||||||||||||||||||||||||:||||||||:|||||||:||||||||||||||||||
Zfish   268 LINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLM 332

  Fly   355 DGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMKLHDDVDLE 419
            ||:|:.:|:|||||||||||||||||||||||||:||||||||||||:|:||||||||.||||||
Zfish   333 DGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLE 397

  Fly   420 QIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPS 484
            |:|.|:|||||||||:||||||||.||:|||||||||:.|||||:.||||||::||:|:::|:||
Zfish   398 QVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPS 462

  Fly   485 ALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLL 549
            |||||||||||.||.|||||:.||:|||||||||||||||||||||.||:|||||||||||||||
Zfish   463 ALRETVVEVPNITWEDIGGLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLL 527

  Fly   550 AKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGD 614
            ||||||||||||||:||||||||||||||||||:||||||.||||||||||||||||||||||||
Zfish   528 AKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGD 592

  Fly   615 AGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAIL 679
            .||||||||||||||||||.:||||||||||||||||||||||||||||||||||||:|||.|||
Zfish   593 GGGAADRVINQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAIL 657

  Fly   680 KANLRKSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMD 744
            ||||||||::|:|||.::||:|.||||||||||||||||||||::||.|||||:||..|. |||:
Zfish   658 KANLRKSPISKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNP-SAME 721

  Fly   745 MDEDDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQNFRFP----GQTGNTS 805
            ::||||||||...||||||:|||||||||||||||||||||||||||| :||||    |.:|.:.
Zfish   722 VEEDDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFG-SFRFPSSNQGGSGPSQ 785

  Fly   806 GSGNNLPVNSPGDNGDDDLY 825
            ||......|...::.|||||
Zfish   786 GSSGGGGGNVFNEDNDDDLY 805

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 631/740 (85%)
CDC48_N 47..129 CDD:280513 67/82 (82%)
CDC48_2 153..213 CDD:215011 45/60 (75%)
AAA 263..392 CDD:278434 119/129 (92%)
AAA 536..669 CDD:278434 127/133 (95%)
Vps4_C <741..783 CDD:286426 35/42 (83%)
vcpNP_958889.1 CDC48 25..764 CDD:273521 631/740 (85%)
CDC48_N 25..107 CDD:280513 67/82 (82%)
CDC48_2 131..191 CDD:215011 45/60 (75%)
AAA 241..370 CDD:278434 119/129 (92%)
P-loop_NTPase 452..>534 CDD:304359 70/82 (85%)
AAA 514..647 CDD:278434 127/133 (95%)
Vps4_C <718..760 CDD:286426 35/42 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C298866090
eggNOG 1 0.900 E1_COG0464
Hieranoid 1 1.000
Homologene 1 1.000 H5168
Inparanoid 1 1.050 1333 1.000 Inparanoid score I131
OMA 1 1.010
OrthoDB 1 1.010 D169540at33208
OrthoFinder 1 1.000 FOG0000162
OrthoInspector 1 1.000 T596818
orthoMCL 1 0.900 OOG5_126926
Panther 1 1.100 LDO PTHR23077
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R182
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.