DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12134 and HAT2

DIOPT Version :9

Sequence 1:NP_001369072.1 Gene:CG12134 / 36038 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_010858.3 Gene:HAT2 / 856654 SGDID:S000000782 Length:401 Species:Saccharomyces cerevisiae


Alignment Length:320 Identity:60/320 - (18%)
Similarity:120/320 - (37%) Gaps:85/320 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFNKYCE-EAAREALPDSEDEEDIGDEDTCSAQ------DLAAEFQ-------LKYKPQDE---- 49
            ::.|:.| ...:|.|.:.:.:|:.|:|...|..      .:.|:::       .:|.|||.    
Yeast    71 NYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVA 135

  Fly    50 ----------VSVSLQREYVLSLAADQGFS---------RMAAGLSNSAVHIYNLDSGAGKLENF 95
                      .|.|...:..|....|.|::         |:.:|..:..|.::.:.||.      
Yeast   136 TINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGG------ 194

  Fly    96 SYLPPTDSPQSVSICGVRFLDEGP-HNI---LVGTT--DGYVRLYDLRLRGEQARFKYTQHPNVP 154
               .||...::.:......:::.. ||.   |.||.  |..:::.|:|...       |....|.
Yeast   195 ---DPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN-------TTIDTVK 249

  Fly   155 -PVPKSLSCFDRNANGRIICCGTEQFHSNAFLVFFDVRERQQMGVYFESHEDDITSLRFHAQNPD 218
             |.|.:...|..:::..:...|.:     :::..:|:|..::...:...|||.:.:|.|......
Yeast   250 CPQPFNTLAFSHHSSNLLAAAGMD-----SYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHVDG 309

  Fly   219 LLATGSVDGLVNVFDVKE------PDEDEALLNTFNTESSVARL----AWHR-NVYDKDI 267
            ::.:...|..:.::|:|:      ||:         .|..|..|    |.|| :|.|.|:
Yeast   310 VVVSSGSDNRLMMWDLKQIGAEQTPDD---------AEDGVPELIMVHAGHRSSVNDFDL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12134NP_001369072.1 WD40 56..384 CDD:421866 45/239 (19%)
WD40 repeat 59..101 CDD:293791 8/50 (16%)
WD40 repeat 108..146 CDD:293791 8/43 (19%)
WD40 repeat 153..201 CDD:293791 7/48 (15%)
WD40 repeat 207..248 CDD:293791 7/46 (15%)
WD40 repeat 300..353 CDD:293791
WD40 repeat 359..390 CDD:293791
HAT2NP_010858.3 CAF1C_H4-bd 12..82 CDD:403473 2/10 (20%)
WD40 <116..401 CDD:225201 51/275 (19%)
WD40 repeat 122..158 CDD:293791 7/35 (20%)
WD40 repeat 163..204 CDD:293791 8/49 (16%)
WD40 repeat 212..247 CDD:293791 9/41 (22%)
WD40 repeat 254..292 CDD:293791 4/42 (10%)
WD40 repeat 298..349 CDD:293791 10/59 (17%)
WD40 repeat 355..380 CDD:293791 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.