DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12134 and YNL035C

Sequence 1:NP_610542.1 Gene:CG12134 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_014363.1 Gene:YNL035C SGDID:S000004980 Length:389 Species:Saccharomyces cerevisiae

Alignment Length:403 Identity:87/404 (22%)
Similarity:160/404 (40%) Gaps:104/404 (26%)


  Fly    71 MAAGLSNSAVHIYNLDSGAGKLENFSYLPPTDSP-QSVSICGVRFLDEGPHNILVGTTDGYVRLY 134
            :..||||..:.:  ||...||  :...:..:::. ..:.:.|..|  ...|.:...:.|. |:::
Yeast    29 LLTGLSNGEIRL--LDWSTGK--SVQKIKASETAINDMKVIGSDF--SAGHLVSSASIDA-VKVF 86

  Fly   135 DLRLRGEQARFKYTQHPNVPPVPKSLSCFDRNANGRIICCGTEQFHSNAFLVFFDVRE-RQQMGV 198
            |:|.....|:.:  ...|.|    .:|...|:.   ::.||||....:|.:..:|:|: ...:..
Yeast    87 DIRTNDRIAQIQ--NEANSP----FISLDSRHG---LLACGTELQGIDAAVYIYDIRKWDTPLRS 142

  Fly   199 YFESHEDDITSLRFHAQNPDLLATGSVDGLVNVFDVKEPDEDEALLNTFNTESSVARLAWHRNVY 263
            ..:||.||:|.::||..:.::|.:||.||..|::|:|:.:|::||....|..|            
Yeast   143 LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYAS------------ 195

  Fly   264 DKDIISC-------VTTTGDFKSYECEEGDEVASFERPDVTAAIRRKKAANF----NLINAHNQE 317
               |.||       :.|....:::        |..|..|.:..::..:..:|    .:.|.....
Yeast   196 ---IHSCGWLSPKRIFTLSHMETF--------AIHELNDKSDELKEPQPLDFGDVREIWNCDYVV 249

  Fly   318 D--GGVFLLAGTNFNKGEI----LRSVSVTSKNSLQ-PLANFQGNKQIVRDSLFDSKRS-LLFTG 374
            |  .|:.....|..|.||:    .:...|.::|.:. |.|:   ..::|||....::.| :|::.
Yeast   250 DIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAH---GDEVVRDIFIPAQHSNMLYSC 311

  Fly   375 GESGIVTVWA------------------------QDASGTAFSSEKLKARKE-----------KK 404
            ||.|.|.:|.                        .|..|:....|.|..:||           ||
Yeast   312 GEDGCVKIWENKQGPLDIPENFWDYSKKMNVLGDDDREGSINLDEPLIIQKESVSTRPRKEKHKK 376

  Fly   405 SRKQA------PY 411
            ::|.:      ||
Yeast   377 AKKHSMKSRFKPY 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12134NP_610542.1 WD40 56..384 CDD:295369 76/334 (23%)
WD40 repeat 59..101 CDD:293791 8/30 (27%)
WD40 108..>383 CDD:225201 67/295 (23%)
WD40 repeat 108..146 CDD:293791 8/38 (21%)
WD40 repeat 153..201 CDD:293791 10/49 (20%)
WD40 repeat 207..248 CDD:293791 14/41 (34%)
WD40 repeat 300..353 CDD:293791 12/64 (19%)
WD40 repeat 359..390 CDD:293791 12/56 (21%)
YNL035CNP_014363.1 WD40 4..370 CDD:225201 82/383 (21%)
WD40 <17..212 CDD:295369 51/214 (24%)
WD40 repeat 59..98 CDD:293791 8/42 (19%)
WD40 repeat 106..144 CDD:293791 9/41 (22%)
WD40 140..>325 CDD:295369 49/211 (23%)
WD40 repeat 151..183 CDD:293791 11/32 (34%)
WD40 repeat 242..282 CDD:293791 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191975150
eggNOG 1 0.900 E1_KOG1188
Hieranoid 1 1.000
Homologene 1 1.000 H43791
Inparanoid 1 1.050 65 1.000 Inparanoid score I1715
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005140
OrthoInspector 1 1.000 T1135876
orthoMCL 1 0.900 OOG5_129888
Panther 1 1.100 LDO PTHR22889
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1749
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.