DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12134 and Wdr89

Sequence 1:NP_610542.1 Gene:CG12134 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_082479.1 Gene:Wdr89 MGIID:1919588 Length:386 Species:Mus musculus

Alignment Length:385 Identity:111/386 (29%)
Similarity:164/386 (42%) Gaps:74/386 (19%)


  Fly    61 SLAADQGFSRMAAGLSNSAVHIYNLDS---------GAGKLENFSYLPPTDSPQSVSICGVRFLD 116
            ::.||:| ..:|...||.::.||:.::         ..|.|...|:....||..|.|        
Mouse    34 TVQADKG-GLVAVLCSNGSIRIYDKETLHLLREFGGSPGLLSGVSFANSCDSVYSAS-------- 89

  Fly   117 EGPHNILVGTTDGYVRLYDLRLRGEQARFKYTQHPNVPPVPKSLSCFDRNANGRIICCGTEQFHS 181
                      |||.|:.:|.|...|:....:..:|:.     |...||.|....:||.|.|:...
Mouse    90 ----------TDGTVKCWDARGASEKPVQLFKGYPSC-----SFISFDVNCKDHVICAGAEKVDE 139

  Fly   182 NAFLVFFDVR-------ERQQMGVYFESHEDDITSLRFHAQNPDLLATGSVDGLVNVFDVKEPDE 239
            :|.|||:|.|       .|..:|.|.|:|.||||.:|||..||:|:.:||.||||||||:....|
Mouse   140 DALLVFWDARFTSQDLSTRDPLGAYSETHSDDITQVRFHPSNPNLVVSGSTDGLVNVFDLSADKE 204

  Fly   240 DEALLNTFNTESSVARLAWHRNVYDKDIISCVTTTGDFKSYECE--EGDE-VASFERPDVTAAIR 301
            ::||:.|.|:.|||:.:.|....|.:  |.|:|....|..::..  :.|| :......||.....
Mouse   205 EDALVATCNSVSSVSCIGWCGKDYKQ--IYCMTHDEGFCWWDLNHLDTDEPITCLNIQDVREITD 267

  Fly   302 RKKAANFNLINA--HNQEDGGVFLLAGTNFNKGEIL--RSVSVTSKNSLQPLANFQGNKQIVRDS 362
            .|......||..  |.:.| .:|::.|||..|..:|  .|..:|...||.     .|:...||..
Mouse   268 VKDGHLDYLIGGLYHEKMD-RLFVIGGTNTGKIHLLSCTSAGLTHVTSLH-----GGHAATVRSF 326

  Fly   363 LFDSKRSLLFTGGESGIVTVWAQDASGTAF-------------------SSEKLKARKEK 403
            .::.....|.||||...:.:|...|....|                   ||:..|.||::
Mouse   327 CWNVSEDSLLTGGEDAQLLLWKPGAMEKTFTKKDSLKIASSVQQRVRVHSSDSYKKRKQQ 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12134NP_610542.1 WD40 56..384 CDD:295369 104/346 (30%)
WD40 repeat 59..101 CDD:293791 11/49 (22%)
WD40 108..>383 CDD:225201 89/289 (31%)
WD40 repeat 108..146 CDD:293791 8/38 (21%)
WD40 repeat 153..201 CDD:293791 17/55 (31%)
WD40 repeat 207..248 CDD:293791 22/41 (54%)
WD40 repeat 300..353 CDD:293791 15/57 (26%)
WD40 repeat 359..390 CDD:293791 9/31 (29%)
Wdr89NP_082479.1 WD 1 21..65 8/32 (25%)
WD40 <26..101 CDD:225201 21/86 (24%)
WD40 38..348 CDD:295369 103/342 (30%)
WD40 65..>348 CDD:225201 96/314 (31%)
WD 2 68..107 14/57 (25%)
WD40 repeat 74..111 CDD:293791 12/55 (22%)
WD 3 112..156 15/49 (31%)
WD40 repeat 116..159 CDD:293791 15/48 (31%)
WD 4 167..207 22/40 (55%)
WD40 repeat 172..213 CDD:293791 22/41 (54%)
WD 5 213..253 12/42 (29%)
WD40 repeat 218..243 CDD:293791 7/27 (26%)
WD40 repeat 277..316 CDD:293791 13/40 (33%)
WD 6 318..357 11/39 (28%)
WD40 repeat 323..347 CDD:293791 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191970650
eggNOG 1 0.900 E1_KOG1188
Hieranoid 1 1.000
Homologene 1 1.000 H43791
Inparanoid 1 1.050 123 1.000 Inparanoid score I4686
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005140
OrthoInspector 1 1.000 T1083056
orthoMCL 1 0.900 OOG5_129888
Panther 1 1.100 LDO PTHR22889
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1749
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.