DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12134 and SPCC63.06

Sequence 1:NP_610542.1 Gene:CG12134 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_587980.1 Gene:SPCC63.06 PomBaseID:SPCC63.06 Length:331 Species:Schizosaccharomyces pombe

Alignment Length:366 Identity:89/367 (24%)
Similarity:162/367 (44%) Gaps:59/367 (16%)


  Fly    25 IGDEDTCSAQDLAAEFQLKYKPQDEVSVSLQREYVLSLAADQGFSRMAAGLSNSAVHIYNLDSGA 89
            :.:||.|...|:.   |||    |.|.||      .|..:...|.:      .:.:.|:.:....
pombe    10 VSNEDECFIYDIE---QLK----DNVVVS------YSTGSWSCFDK------GTLLEIFKVPKAH 55

  Fly    90 GKLENFSYLPPTDSPQSVSICGVRFLDEGPHNILVGTTDGYVRLYDLRLRGEQARFKYTQHPNVP 154
               .|.:.:...|....|..||               ::|.:.|:|:|.:.:.|...:||. :.|
pombe    56 ---TNITGIISCDQLNGVITCG---------------SEGEIHLWDIRSQAKSAVRSWTQQ-STP 101

  Fly   155 PVPKSLSCFDRNANGRIICCGTEQFHSNAFLVFFDVRERQQM-GVYFESHEDDITSLRFHAQNPD 218
                 .:|...|...: ...|:|...|.|.:..:|||..|:: ..:.::|.||||.|:||.::.:
pombe   102 -----FTCIALNKKNQ-FATGSELTRSLASVQLWDVRSEQKLIRQWNDAHNDDITHLQFHPKDNE 160

  Fly   219 LLATGSVDGLVNVFD-VKEPD----EDEALLNTFNTESSVARLAWHRNVYDKDIISCVTTTGDFK 278
            ||.||||||||::.| .||.|    |::.||:..|..:|: .||   ....|..:..::....:.
pombe   161 LLLTGSVDGLVSLLDTTKEEDSTDPEEDPLLHVINHGASI-HLA---KFVSKKRVMVLSHMESYA 221

  Fly   279 SYECEEGDEVASFERPDVTAA--IRRKKAANFNLINAHNQEDGGVFLLAGTNFNKGEILRSVSVT 341
            .|:.:...:..::...::.:.  :|.:.:.:: :||..:..|.....||..:|:..|....:..|
pombe   222 MYKLKRDKDEKTWSSNELFSIDDLRAELSCSY-VINEVSTSDKQFCALAFGDFSNHETKFVLVDT 285

  Fly   342 SKNSL--QPLANFQGNKQIVRDSLFDSKRSLLFTGGESGIV 380
            |...|  :|....:.:::|.|...||.|..:.::|||.|::
pombe   286 STGELKKEPTKLERASEEICRAISFDVKNDVYYSGGEDGLL 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12134NP_610542.1 WD40 56..384 CDD:295369 78/336 (23%)
WD40 repeat 59..101 CDD:293791 4/42 (10%)
WD40 108..>383 CDD:225201 72/284 (25%)
WD40 repeat 108..146 CDD:293791 7/38 (18%)
WD40 repeat 153..201 CDD:293791 11/49 (22%)
WD40 repeat 207..248 CDD:293791 22/46 (48%)
WD40 repeat 300..353 CDD:293791 12/55 (22%)
WD40 repeat 359..390 CDD:293791 8/23 (35%)
SPCC63.06NP_587980.1 WD40 5..>331 CDD:225201 89/367 (24%)
WD40 47..>180 CDD:295369 45/158 (28%)
WD40 repeat 59..97 CDD:293791 10/53 (19%)
WD40 repeat 102..142 CDD:293791 10/41 (24%)
WD40 repeat 150..185 CDD:293791 18/35 (51%)
WD40 repeat 200..241 CDD:293791 4/45 (9%)
WD40 repeat 255..298 CDD:293791 11/43 (26%)
Salt_tol_Pase <261..330 CDD:302929 18/67 (27%)
WD40 repeat 305..329 CDD:293791 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H43791
Inparanoid 1 1.050 76 1.000 Inparanoid score I1857
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005140
OrthoInspector 1 1.000 T1124688
orthoMCL 1 0.900 OOG5_129888
Panther 1 1.100 LDO PTHR22889
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1749
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.