DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12134 and T18D3.1

Sequence 1:NP_610542.1 Gene:CG12134 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_510088.1 Gene:T18D3.1 WormBaseID:WBGene00011820 Length:523 Species:Caenorhabditis elegans

Alignment Length:401 Identity:76/402 (19%)
Similarity:144/402 (36%) Gaps:104/402 (26%)


  Fly    50 VSVSLQREYVLSLAADQGFSRMAAGLSNSAVHIYNLDSGAGKLENFSYLPPTDSPQSVSICGVRF 114
            |.:.|.....:.|.:....:...|.|:|..:.|::||||       ..:...:.|.  .|.|:.|
 Worm     3 VRIDLSSNASVRLLSVNDENTACAYLANLYIPIFSLDSG-------KVIRRYEVPN--QIAGIHF 58

  Fly   115 LDEGPHNILVGTTDGY-VRLYDLRLRGEQARFKYTQHPNVPPVPKSLSCFDRNANGRIICCGTEQ 178
             .....:::....|.: :..:|.|   ..::.|:..:|.  ....::.|...::|...|...:.:
 Worm    59 -SFNKKSVIYAVDDSFGLHTFDFR---TDSKKKHRMNPE--SENHNVVCTALSSNSTTIAVASSE 117

  Fly   179 F--------------HSNAFLVFFDVR-ERQQMGVYFESHEDDITSLRFHAQNPDLLATGSVDGL 228
            |              |.:..:..:|:| ....:..||:..:..:||:.|:....||: .|...|.
 Worm   118 FGGGILDVRGSRRREHHHHVVSLYDLRYPNDPITSYFKRLKSSVTSMEFYLNGNDLI-LGDESGS 181

  Fly   229 VNVFDVKEPDEDEALLNTFNTESSVARLAWHR---------NVYDKDII---------------- 268
            :..||.:..|||.|             :.|.|         .|.:|.|:                
 Worm   182 IKSFDCQLRDEDNA-------------VRWERWATGPISKVGVINKRIVYGISRQSQASVFVDSK 233

  Fly   269 -------SCVTTTGDFKSYECEEGDEVASFERPDVTAAIRRKKAANFNLINAHNQEDGGVFLLAG 326
                   ..||.:.|    :...|...|.::.|:....:.:....:..|:..|     ||     
 Worm   234 GKLEVLYGSVTESAD----DPVVGTSKAYYKDPEWCIGLIKGVNDDIPLVGVH-----GV----- 284

  Fly   327 TNFNKGEILRSVSVTSKN-----SLQPLANFQGNKQIVRDSLFDSKRSLLFTGGESGIVTVWAQD 386
               .|.:|   :|:|:.|     ..:|:.:::|:|..|:  ...:.:.||.||||.|.|.|...:
 Worm   285 ---KKKKI---ISMTAMNQDGVRQEKPMLSYKGHKGEVK--CMAATKDLLLTGGEDGKVIVQIAN 341

  Fly   387 ASGTAFSSEKL 397
            .....|..:.:
 Worm   342 FKNPKFGDDNI 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12134NP_610542.1 WD40 56..384 CDD:295369 73/381 (19%)
WD40 repeat 59..101 CDD:293791 9/42 (21%)
WD40 108..>383 CDD:225201 63/328 (19%)
WD40 repeat 108..146 CDD:293791 6/39 (15%)
WD40 repeat 153..201 CDD:293791 9/63 (14%)
WD40 repeat 207..248 CDD:293791 13/41 (32%)
WD40 repeat 300..353 CDD:293791 10/58 (17%)
WD40 repeat 359..390 CDD:293791 10/31 (32%)
T18D3.1NP_510088.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22889
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.