DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12134 and wdr-23

Sequence 1:NP_610542.1 Gene:CG12134 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_492124.1 Gene:wdr-23 WormBaseID:WBGene00008419 Length:571 Species:Caenorhabditis elegans

Alignment Length:498 Identity:94/499 (19%)
Similarity:175/499 (35%) Gaps:156/499 (31%)


  Fly    25 IGDEDTCSAQDLAAEFQLKYKPQDEVSVSLQREYVLSLAADQGFSRMAAGLSN--SAVHIYNLDS 87
            |||.::|:  .|..|...:..|:.  |.|...|::|    ::...:....:||  :...:.|   
 Worm    97 IGDPESCT--QLRNEINSRCGPRP--STSNNMEFIL----NRDLQKRGTSISNPRTVARVLN--- 150

  Fly    88 GAGKLENFSYLP----PTDSPQSVSICGVRFLDEGPHNILVGTTDGYVRLY-------------- 134
                    |:||    ..|...:.|.| .:::..|. .|:|.:.|..:|.|              
 Worm   151 --------SHLPNQKRRVDRVATKSFC-TQYIQNGT-KIVVASQDEKIRFYQRNPDKSKYRSKYM 205

  Fly   135 ---DLR--------------LRGE------------QARFKYTQHPNVPPVPKSLS--------- 161
               :||              |.|:            ..:..:|:..|:...|..|:         
 Worm   206 KSDELRVDQCGWSILDTAISLNGDLIAYGTWKDAVFVGKLDFTERQNITWFPIDLNGEPGRDHCA 270

  Fly   162 --CFDRNANGRIICCGTEQFHSNAFLVFFDVRERQQMGVYFESHEDDITSLRFHAQNPDLLATGS 224
              |...:.:...|.|||.|:..:.    |||.:|:::.....:||||:.|:.|.....:|:.:..
 Worm   271 VFCVKFSDSSEQIVCGTSQYSIHV----FDVEQRRRIRTIVNAHEDDVNSVCFADLGSNLIYSAG 331

  Fly   225 VDGLVNVFDVK-------EP------------------DEDEALLNTFNTESSVARLAWHRNVYD 264
            .||||.|:|.:       ||                  ||...|.|:.:....|..|....|:..
 Worm   332 DDGLVKVWDKRAWSDGDVEPVGVFAGHRDGVTHVDSRQDERYLLSNSKDQTIKVWDLRKFSNMSG 396

  Fly   265 KDII-SCVTTT-GDFKSYECEEG--DEVASFERPDVTAAIRRKKAANFNLINAH--NQEDGGVFL 323
            .:.. :||.:. .|::......|  ..||.    |.:....|..:....|:.|:  .:..|..::
 Worm   397 VEATRACVQSQHWDYRWQPAPPGLCQPVAG----DTSVMTLRGHSVLHTLVRANFSPESTGRRYI 457

  Fly   324 LAGTNFNKGEI----LRSVSVTSKNSLQPLANFQGNKQIVRDSLFDSKRSLLFTGGESGIVTVWA 384
            ..|.  .:||:    :.|.:|:.:        .:|:..:||:..:....:.:.:....|:.|||.
 Worm   458 YTGC--ARGEVVVYDIMSGTVSRR--------LKGHTAVVRECDWHPTENEIVSSAWDGVTTVWT 512

  Fly   385 ----------------------QDASGTAFSSEKLKARKEKKS 405
                                  :|:....|...|.:.|:::|:
 Worm   513 WDERQEGVIAPYDHPNISQFGDEDSCDELFQPVKKQCRRQRKT 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12134NP_610542.1 WD40 56..384 CDD:295369 80/423 (19%)
WD40 repeat 59..101 CDD:293791 7/48 (15%)
WD40 108..>383 CDD:225201 70/364 (19%)
WD40 repeat 108..146 CDD:293791 12/81 (15%)
WD40 repeat 153..201 CDD:293791 12/59 (20%)
WD40 repeat 207..248 CDD:293791 15/66 (23%)
WD40 repeat 300..353 CDD:293791 9/59 (15%)
WD40 repeat 359..390 CDD:293791 7/53 (13%)
wdr-23NP_492124.1 WD40 119..511 CDD:225201 81/427 (19%)
WD40 repeat 167..205 CDD:293791 8/40 (20%)
WD40 168..514 CDD:295369 70/366 (19%)
WD40 repeat 220..269 CDD:293791 6/49 (12%)
WD40 repeat 271..307 CDD:293791 10/40 (25%)
WD40 repeat 315..356 CDD:293791 11/41 (27%)
WD40 repeat 362..434 CDD:293791 14/76 (18%)
WD40 repeat 442..481 CDD:293791 8/49 (16%)
WD40 repeat 487..511 CDD:293791 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.