DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12134 and WDR89

Sequence 1:NP_610542.1 Gene:CG12134 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_011534685.1 Gene:WDR89 HGNCID:20489 Length:425 Species:Homo sapiens

Alignment Length:417 Identity:124/418 (30%)
Similarity:191/418 (46%) Gaps:62/418 (15%)


  Fly    24 DIGDEDTCSAQDLAAEFQLKYKPQDE-------VSVSL---QREYVL----SLAADQGFSRMAAG 74
            :.|...|||...|..:..:..:..:|       |..||   :..|:|    |.....|...:.|.
Human    19 EAGASLTCSRVLLPLDAAVDMEKIEEQFANLHIVKCSLGTKEPTYLLGIDTSKTVQAGKENLVAV 83

  Fly    75 L-SNSAVHIYNLDSGAGKLENFSYLPPTDSPQSVSICGVRFLDEGPHNILVGTTDGYVRLYDLRL 138
            | ||.::.||:.:. ...|..||..|..       :.||||.: ...::....|||.|:.:|.|:
Human    84 LCSNGSIRIYDKER-LNVLREFSGYPGL-------LNGVRFAN-SCDSVYSACTDGTVKCWDARV 139

  Fly   139 RGEQARFKYTQHPNVPPVPKSLSCFDRNANGRIICCGTEQFHSNAFLVFFDVRERQQ-------- 195
            ..|:....:..:|:     .....||.|.|..|||.|||:...:|.|||:|.|...|        
Human   140 AREKPVQLFKGYPS-----NIFISFDINCNDHIICAGTEKVDDDALLVFWDARMNSQNLSTTKDS 199

  Fly   196 MGVYFESHEDDITSLRFHAQNPDLLATGSVDGLVNVFDVKEPDEDEALLNTFNTESSVARLAWHR 260
            :|.|.|:|.||:|.:|||..||:::.:||.||||||||:...:|::||:.|.|:.|||:.:.|..
Human   200 LGAYSETHSDDVTQVRFHPSNPNMVVSGSSDGLVNVFDINIDNEEDALVTTCNSISSVSCIGWSG 264

  Fly   261 NVYDKDIISCVTTTGDFKSYECE--EGDE-VASFERPDVTAAIRRKKAANFNLINA-HNQEDGGV 321
            ..|.:  |.|:|....|..::..  :.|| |......||...:..|:.|...||.. ::::...:
Human   265 KGYKQ--IYCMTHDEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMKEDALDYLIGGLYHEKTDTL 327

  Fly   322 FLLAGTNFNKGEI-LRSVS---VTSKNSLQPLANFQGNKQIVRDSLFDSKRSLLFTGGESGIVTV 382
            .::.||  |||.| |.:.|   :|...|||     .|:...||...::.:...|.||||...:.:
Human   328 HVIGGT--NKGRIHLMNCSMSGLTHVTSLQ-----GGHAATVRSFCWNVQDDSLLTGGEDAQLLL 385

  Fly   383 WAQDASGTAFSSEKLKARKEKKSRKQA 409
            |...|....|:        :|:|.|.|
Human   386 WKPGAIEKTFT--------KKESMKIA 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12134NP_610542.1 WD40 56..384 CDD:295369 109/349 (31%)
WD40 repeat 59..101 CDD:293791 13/47 (28%)
WD40 108..>383 CDD:225201 94/291 (32%)
WD40 repeat 108..146 CDD:293791 11/38 (29%)
WD40 repeat 153..201 CDD:293791 19/56 (34%)
WD40 repeat 207..248 CDD:293791 20/41 (49%)
WD40 repeat 300..353 CDD:293791 16/58 (28%)
WD40 repeat 359..390 CDD:293791 9/31 (29%)
WDR89XP_011534685.1 WD40 69..>387 CDD:225201 107/341 (31%)
WD40 79..387 CDD:295369 105/331 (32%)
WD40 repeat 112..150 CDD:293791 11/39 (28%)
WD40 repeat 156..198 CDD:293791 17/42 (40%)
WD40 repeat 212..250 CDD:293791 19/38 (50%)
WD40 repeat 257..297 CDD:293791 10/42 (24%)
WD40 repeat 305..355 CDD:293791 15/52 (29%)
WD40 repeat 362..386 CDD:293791 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191969699
eggNOG 1 0.900 E1_KOG1188
Hieranoid 1 1.000
Homologene 1 1.000 H43791
Inparanoid 1 1.050 129 1.000 Inparanoid score I4594
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1546666at2759
OrthoFinder 1 1.000 FOG0005140
OrthoInspector 1 1.000 T1072982
orthoMCL 1 0.900 OOG5_129888
Panther 1 1.100 LDO PTHR22889
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1749
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.