DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Etf-QO and Etfdh

DIOPT Version :8

Sequence 1:NP_001246231.1 Gene:Etf-QO / 36031 FlyBaseID:FBgn0286783 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_942037.2 Gene:Etfdh / 295143 RGDID:735052 Length:616 Species:Rattus norvegicus

Alignment Length:592 Identity:398/593 (67%)
Similarity:479/593 (81%) Gaps:4/593 (1%)


  Fly    16 PALARSISDVAKYPRITTHYTLNPREKDERWTEVDMERCVEEVDLVIVGGGPAGMSAAIRAKQLA 80
            |..|...|..:..|:||||||::|||||:||..|:|||..||.|:||||.||||:|||||.||||
  Rat    26 PLCAPRCSSTSAVPQITTHYTIHPREKDKRWEGVNMERFAEEADVVIVGAGPAGLSAAIRLKQLA 90

  Fly    81 AEKDQEIRVCVVEKAAEVGGHILSGAVIDPISLNELIPDWQEQGAPLNTPVTKDTFSFLTGSGRI 145
            ||::::||||:|||||::|.|.||||.:||.:..||.|||:|:|||||||||:|.|:.||...||
  Rat    91 AEQEKDIRVCLVEKAAQIGAHTLSGACLDPAAFKELFPDWKEKGAPLNTPVTEDRFAILTEKHRI 155

  Fly   146 SIPVFKGWPMDNHGNYVVRLGHLVKWLGDQAEALGVEIYPGCAASEVLFHEDGSVKGIATNDVGI 210
            .:|:..|.||:|||||:|||||||.|:|:||||||||:|||.||:|||:||||||||||||||||
  Rat   156 PVPILPGLPMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLYHEDGSVKGIATNDVGI 220

  Fly   211 AKSGAPKDTFARGMELHAKTTIFAEGCRGHLTKQIMQKFGLNEGSEPQAYGIGLKEVWEIAPEKH 275
            .|.||||.||.||:|||||.|||||||.|||.||:.:||.|....:.|.|||||||:|.|..:|.
  Rat   221 QKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRASCDAQTYGIGLKELWVIDEKKW 285

  Fly   276 QPGLVEHTIGWPLDRFTYGGSFLYHLNEPTPTIAVGFVVGLNYKNPWLSPFQEFQRFKTHPKVRD 340
            :||.|:||:||||||.||||||||||||..|.:||||||||:|:||:||||:||||:|.||.:|.
  Rat   286 KPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVAVGFVVGLDYQNPYLSPFREFQRWKHHPSIRP 350

  Fly   341 VFEGATRIAYGARAINEGGFQSLPQKLSFPGGCLVGCSAGFLNVPRIKGSHYAMKSGMLAAESAF 405
            ..||..||||||||:||||.||:| ||:||||.|:|||.||:|||:|||:|.|||||.||||:.|
  Rat   351 TLEGGKRIAYGARALNEGGLQSIP-KLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGSLAAEAIF 414

  Fly   406 EAINAD--AQSTAGVEPTGYAEKIKDSFVWKDLYSVRNVHPSFHNPLGLYGGLVLSG-FSIFMGG 467
            :.:.::  ...|||:..|.|.:.:|.|:|||:|::|||:.||.|..||:|||::.:| |...:.|
  Rat   415 KQLTSENLQSKTAGLHVTEYEDNLKQSWVWKELHAVRNIRPSCHGILGVYGGMIYTGIFYWILRG 479

  Fly   468 REPWTLKHGPQDHESLKPASSCPPIVYPKPDGKISFDLLSSVALTGTNHEGDQPAHLTLKDDRIP 532
            .|||||||...|.|.||||..|.||.||||||:|||||||||||:|||||.|||||||||||.||
  Rat   480 MEPWTLKHKGSDSEQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLKDDSIP 544

  Fly   533 VDHNLALYEGPEQRFCPAGVYEYVPNEEGGNMKLQINAQNCIHCKTCDIKDPKQNINWVVPEGGG 597
            |:.||::|:|||||||||||||:||.|:|...:||||||||:||||||||||.||||||||||||
  Rat   545 VNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGG 609

  Fly   598 GPAYNGM 604
            |||||||
  Rat   610 GPAYNGM 616

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Etf-QONP_001246231.1 NADB_Rossmann 44..>206 CDD:304358 111/162 (69%)
FixC 56..516 CDD:223717 304/463 (66%)
ETF_QO 499..602 CDD:282972 85/103 (83%)
EtfdhNP_942037.2 FixC 66..528 CDD:223717 304/463 (66%)
NADB_Rossmann 67..>261 CDD:304358 137/194 (71%)
ETF_QO 511..614 CDD:282972 85/103 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C326649554
eggNOG 1 0.900 E1_COG2440
Hieranoid 1 1.000
Homologene 1 1.000 H3275
Inparanoid 1 1.050 851 1.000 Inparanoid score I405
OMA 1 1.010
OrthoDB 1 1.010 D180808at33208
OrthoFinder 1 1.000 FOG0004291
OrthoInspector 1 1.000 T1086605
orthoMCL 1 0.900 OOG5_128337
Panther 1 1.100 LDO PTHR10617
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.