DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Etf-QO and ETFDH

DIOPT Version :8

Sequence 1:NP_001246231.1 Gene:Etf-QO / 36031 FlyBaseID:FBgn0286783 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_004444.2 Gene:ETFDH / 2110 HGNCID:3483 Length:617 Species:Homo sapiens

Alignment Length:599 Identity:396/600 (66%)
Similarity:479/600 (80%) Gaps:4/600 (1%)


  Fly     9 RVRRLFSPALARSISDVAKYPRITTHYTLNPREKDERWTEVDMERCVEEVDLVIVGGGPAGMSAA 73
            ::::.:.|..|...|..:..||||||||:.||:||:||..|:|||..||.|:||||.||||:|||
Human    20 KIKKNYLPLCATRWSSTSTVPRITTHYTIYPRDKDKRWEGVNMERFAEEADVVIVGAGPAGLSAA 84

  Fly    74 IRAKQLAAEKDQEIRVCVVEKAAEVGGHILSGAVIDPISLNELIPDWQEQGAPLNTPVTKDTFSF 138
            :|.||||...:::||||:|||||::|.|.||||.:||.:..||.|||:|:|||||||||:|.|..
Human    85 VRLKQLAVAHEKDIRVCLVEKAAQIGAHTLSGACLDPGAFKELFPDWKEKGAPLNTPVTEDRFGI 149

  Fly   139 LTGSGRISIPVFKGWPMDNHGNYVVRLGHLVKWLGDQAEALGVEIYPGCAASEVLFHEDGSVKGI 203
            ||...||.:|:..|.||:|||||:|||||||.|:|:||||||||:|||.||:|||||:|||||||
Human   150 LTEKYRIPVPILPGLPMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGI 214

  Fly   204 ATNDVGIAKSGAPKDTFARGMELHAKTTIFAEGCRGHLTKQIMQKFGLNEGSEPQAYGIGLKEVW 268
            |||||||.|.||||.||.||:|||||.|||||||.|||.||:.:||.|....|||.|||||||:|
Human   215 ATNDVGIQKDGAPKATFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELW 279

  Fly   269 EIAPEKHQPGLVEHTIGWPLDRFTYGGSFLYHLNEPTPTIAVGFVVGLNYKNPWLSPFQEFQRFK 333
            .|..:..:||.|:||:||||||.||||||||||||..|.:|:|.||||:|:||:||||:||||:|
Human   280 VIDEKNWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWK 344

  Fly   334 THPKVRDVFEGATRIAYGARAINEGGFQSLPQKLSFPGGCLVGCSAGFLNVPRIKGSHYAMKSGM 398
            .||.:|...||..||||||||:|||||||:| ||:||||.|:|||.||:|||:|||:|.|||||:
Human   345 HHPSIRPTLEGGKRIAYGARALNEGGFQSIP-KLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGI 408

  Fly   399 LAAESAFEAINAD--AQSTAGVEPTGYAEKIKDSFVWKDLYSVRNVHPSFHNPLGLYGGLVLSG- 460
            |||||.|..:.::  ...|.|:..|.|.:.:|:|:|||:||||||:.||.|..||:|||::.:| 
Human   409 LAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGI 473

  Fly   461 FSIFMGGREPWTLKHGPQDHESLKPASSCPPIVYPKPDGKISFDLLSSVALTGTNHEGDQPAHLT 525
            |...:.|.|||||||...|.|.||||..|.||.||||||:|||||||||||:|||||.|||||||
Human   474 FYWILRGMEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLT 538

  Fly   526 LKDDRIPVDHNLALYEGPEQRFCPAGVYEYVPNEEGGNMKLQINAQNCIHCKTCDIKDPKQNINW 590
            |:||.|||:.||::|:|||||||||||||:||.|:|...:||||||||:||||||||||.|||||
Human   539 LRDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINW 603

  Fly   591 VVPEGGGGPAYNGM 604
            ||||||||||||||
Human   604 VVPEGGGGPAYNGM 617

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Etf-QONP_001246231.1 NADB_Rossmann 44..>206 CDD:304358 108/162 (67%)
FixC 56..516 CDD:223717 303/463 (65%)
ETF_QO 499..602 CDD:282972 84/103 (82%)
ETFDHNP_004444.2 FixC 67..529 CDD:223717 303/463 (65%)
NADB_Rossmann 68..>217 CDD:304358 101/149 (68%)
ETF_QO 512..615 CDD:282972 84/103 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C326650849
eggNOG 1 0.900 E1_COG2440
Hieranoid 1 1.000
Homologene 1 1.000 H3275
Inparanoid 1 1.050 849 1.000 Inparanoid score I430
Isobase 1 0.950 0 Normalized mean entropy S422
OMA 1 1.010
OrthoDB 1 1.010 D180808at33208
OrthoFinder 1 1.000 FOG0004291
OrthoInspector 1 1.000 T1072956
orthoMCL 1 0.900 OOG5_128337
Panther 1 1.100 LDO PTHR10617
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R420
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.