DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1513 and OSBPL10

DIOPT Version :10

Sequence 1:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_005264900.1 Gene:OSBPL10 / 114884 HGNCID:16395 Length:769 Species:Homo sapiens


Alignment Length:141 Identity:26/141 - (18%)
Similarity:52/141 - (36%) Gaps:31/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LHVYHHSFMVLTTYCALVFVPGG------------HVLLLGLWNTLV---------HAIMY--FY 188
            |..|...|..:.:....:::.||            ::.||..||.:.         ::::|  ..
Human   315 LPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKI 379

  Fly   189 YFLSSLGAQNHSIWWKKYLT---RLQLIQFIHLAFHFGRPLLSGNCNFPKFWLWYGFLQAIFVLG 250
            |.|..||...:....::|.|   :.:.:..:..|.|.....:.|.    |.:::.|..:|....|
Human   380 YTLGGLGVAGNVDHVERYDTITNQWEAVAPLPKAVHSAAATVCGG----KIYVFGGVNEAGRAAG 440

  Fly   251 LFLDFYIKTYN 261
            : |..|:...|
Human   441 V-LQSYVPQTN 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444
Oxysterol_BP 421..767 CDD:460126
OSBPL10XP_005264900.1 PH_ORP10_ORP11 77..183 CDD:270106
Oxysterol_BP 402..750 CDD:460126 10/54 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.