DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsm11 and C49H3.4

DIOPT Version :8

Sequence 1:NP_610522.1 Gene:Lsm11 / 36013 FlyBaseID:FBgn0033450 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_501319.2 Gene:C49H3.4 / 183627 WormBaseID:WBGene00016791 Length:223 Species:Caenorhabditis elegans

Alignment Length:226 Identity:52/227 (23%)
Similarity:89/227 (39%) Gaps:76/227 (33%)


  Fly    79 GDQGTSKKASTSE----AVDILPP--------ERRFEPHQMPTTSSRKKHHRNIFTYMEAAV--- 128
            |.:|.|:...|.|    .||:.|.        :.|....:...|.|:|:..|:....:||.:   
 Worm    24 GVEGNSEDFKTDEFEKNLVDLHPELAEEICDFDERTVREEKEKTISKKQQARDRQIRLEAMMTDG 88

  Fly   129 -------------------GPLELLTKCISPASHNESNERR---RVRVVIRKHGSVGGSVEGELL 171
                               ||:.::...:       .|::|   |||..||    :....||...
 Worm    89 RSVIEKKGITFHDKMITIEGPMSMIANAV-------INQKRIEVRVRSAIR----IDRIFEGIPT 142

  Fly   172 AFDKQWNLLLRNVTET----WKRRKYNYGEQNICDTPVDCTGRLKELGITLPRTV---------V 223
            .||:.:||::::||||    .|.:|             :.|.| ||:.:.||..:         :
 Worm   143 TFDEHFNLMMKDVTETVLHGRKAQK-------------EFTNR-KEMQLLLPEFLRWKEGGNWPM 193

  Fly   224 KNLNRKNVEIRRELPQILIRGENVVLVSLIP 254
            |....:.:|.|.: ....|:|::||||.::|
 Worm   194 KVGTNRLIEHRFQ-RACFIKGDSVVLVRMLP 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lsm11NP_610522.1 LSm11_M <158..204 CDD:212485 12/50 (24%)
Sm_like <166..252 CDD:294186 27/99 (27%)
C49H3.4NP_501319.2 Sm_like 120..221 CDD:294186 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C151486507
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21415
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.