DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsm11 and LSM11

DIOPT Version :8

Sequence 1:NP_610522.1 Gene:Lsm11 / 36013 FlyBaseID:FBgn0033450 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_775762.1 Gene:LSM11 / 134353 HGNCID:30860 Length:360 Species:Homo sapiens

Alignment Length:378 Identity:90/379 (24%)
Similarity:126/379 (33%) Gaps:146/379 (39%)


  Fly     1 MESRDRKTSNEDDSSEI----SELDVGSDRFNPLRALYEPNFRVTDAVPKVIY------QNLAAF 55
            ||.|:|...:....|..    ..|||.||.|:||.|||.|.      :|.:.|      .|:|.:
Human     1 MEERERGARSAGAGSPARPPSPRLDVSSDSFDPLLALYAPR------LPPIPYPNAPCFNNVAEY 59

  Fly    56 ESALKKFGI--WQLNKRQKPGSAEG-------GDQGTSKKASTSEAVDILPPERRFEPHQMPTTS 111
            ||.|:. |:  ....:.:..|:|.|       |..|.:::...:.|.|   |||.....::....
Human    60 ESFLRT-GVRGGGRGRGRARGAAAGSGVPAAPGPSGRTRRRPDAPAPD---PERIQRLRRLMVAK 120

  Fly   112 SR---------------KKHHRNIFTYMEAAVG-PLELLTKCISPASHNESNERRRVRVVIRKHG 160
            ..               :|..||:.|.|....| ||..|.:||        .|..:|.|.||...
Human   121 EEGDGAAGAGRRGPGRSRKAPRNVLTRMPLHEGSPLGELHRCI--------REGVKVNVHIRTFK 177

  Fly   161 SVGGSVEGELLAFDKQWNLLLRNVTETWKRRKYNYGEQNICDTPVDCT---GRLK---------- 212
            .:.|...|.|:||||.||:.|.:|.||:  ||...|:....|:.:..|   .|||          
Human   178 GLRGVCTGFLVAFDKFWNMALTDVDETY--RKPVLGKAYERDSSLTLTRLFDRLKLQDSSKKEAD 240

  Fly   213 ----------------------------------------------------------------- 212
                                                                             
Human   241 SKSAVEDSTLSRYSQTSTWKLASVWGRADTGRGSHKRSRSVPSSLQASAREESRSELSGRTTRTD 305

  Fly   213 --ELGITLPR--TVVKNLNRKNVE---------IRRELPQILIRGENVVLVSL 252
              .:|.|..|  |:.:..:||...         ..|.:.||.||||||:||.|
Human   306 GSSVGGTFSRATTLSRGQSRKKKRKPKVDYQQVFTRHINQIFIRGENVLLVHL 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lsm11NP_610522.1 LSm11_M <158..204 CDD:212485 17/46 (37%)
Sm_like <166..252 CDD:294186 37/177 (21%)
LSM11NP_775762.1 LSm11_M 159..224 CDD:212485 26/75 (35%)
SM 1 171..204 15/33 (45%)
SM 2 343..356 9/13 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C151488727
eggNOG 1 0.900 E1_2CMUN
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5338
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1605022at2759
OrthoFinder 1 1.000 FOG0006841
OrthoInspector 1 1.000 T1072193
orthoMCL 1 0.900 OOG5_134634
Panther 1 1.100 LDO PTHR21415
Phylome 1 0.910 0.900 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4857
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.