DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsm11 and lsm11

DIOPT Version :8

Sequence 1:NP_610522.1 Gene:Lsm11 / 36013 FlyBaseID:FBgn0033450 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017214640.2 Gene:lsm11 / 100004030 ZFINID:ZDB-GENE-050309-124 Length:403 Species:Danio rerio

Alignment Length:317 Identity:80/318 (25%)
Similarity:128/318 (40%) Gaps:84/318 (26%)


  Fly     2 ESRDRKTSNEDDSSEISELDVGSDRFNPLRALYEPNFRVTDAVPKV-IYQNLAAFESALKKFGIW 65
            ||..:....::|..| ::||:.||:|:||.|||.|  :|....|.: .:.|:|.:||.:|..   
Zfish   102 ESTGQNPETDEDDVE-TKLDIRSDKFDPLLALYSP--QVPLPYPNIKCFNNIAEYESFMKGG--- 160

  Fly    66 QLNKRQKPGSAEGGDQGTSKKASTSEAVDIL-------PPERRFEPHQMPTTSSRKKHHRNIFTY 123
              ..|.||.:.|...:...|..:..|.::.|       |.....|...:.....::|..:|:.|.
Zfish   161 --RGRAKPENVEKRLRKAQKGKADPERIERLKRLMVNNPVPEEGEGSGVKRPPRQRKTAKNVLTR 223

  Fly   124 MEAAVG-PLELLTKCISPASHNESNERRRVRVVIRKHGSVGGSVEGELLAFDKQWNLLLRNVTET 187
            |....| ||..|.:|:        .|:.||:|.||....:.|...|.::||||.|||.:.:|.||
Zfish   224 MPLHTGSPLGQLNRCV--------QEKIRVKVHIRTFKGLRGVCSGFVVAFDKFWNLAMVDVDET 280

  Fly   188 WK----------------------------------RRKYNYGEQNICDTPVDCTGRLKELG--- 215
            ::                                  .||  .|::.:...|...:.:||:..   
Zfish   281 YREPLLGQALYHEKALTITRLFEKLKVQETAALSAVERK--QGDKLLKSDPRSGSSQLKDQSRRS 343

  Fly   216 ----------------ITLPRTVVKNLNRKNVEI----RRELPQILIRGENVVLVSL 252
                            .|..|.:.|..:|..||.    .|.:.|:.||||||:||::
Zfish   344 DSRHNKEKPELSEIDKSTSSREMQKPESRPKVEYGRVHTRHVNQLFIRGENVLLVNI 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lsm11NP_610522.1 LSm11_M <158..204 CDD:212485 15/80 (19%)
Sm_like <166..252 CDD:294186 33/143 (23%)
lsm11XP_017214640.2 LSm11_M 235..300 CDD:212485 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C151488120
eggNOG 1 0.900 E1_2CMUN
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1605022at2759
OrthoFinder 1 1.000 FOG0006841
OrthoInspector 1 1.000 T1051653
orthoMCL 1 0.900 OOG5_134634
Panther 1 1.100 LDO PTHR21415
Phylome 1 0.910 0.900 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4857
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.