DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1698 and CG8850

Sequence 1:NP_001260835.1 Gene:CG1698 FlyBaseID:FBgn0033443 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster

Alignment Length:640 Identity:346/641 (54%)
Similarity:453/641 (71%) Gaps:39/641 (6%)


  Fly    35 KPNESSNGKKTLSEGSGSAPPPGHGDSPSGVEAGQPGK--------------KRDSWNNDIEFLM 85
            |...:..|.:...||.     ||..|..|.|.....|:              :||.|:..:|||.
  Fly     9 KLRRNMQGAQGSREGH-----PGSNDGISTVIYSAEGEELTINCEAESESSGQRDQWSRGVEFLF 68

  Fly    86 SCIALSVGLGNVWRFPFTALENGGGAFVIPYLIVLILVGKPVYYLEMLLGQFSSRGSVKVYDFSP 150
            |||||||||||||||||.|||||||||:|||:|||:|:|:||||||:::|||||||.::.:|.:|
  Fly    69 SCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAP 133

  Fly   151 IMRGIGYGQVLATGIVTTYYATLMALTLRYFVDSFYPTLPWSYCREEWGTECLDSGPQEASRATS 215
            |||||.||||.:|.:.|||||.:||||:||.|.||...|||:||..|||..|:.:|...|:.::.
  Fly   134 IMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWGKSCVATGATAANDSSI 198

  Fly   216 LAGSGVRTTSAEFYFTNIILREKASIDD-GIGYPSWSLALALAVAWIVIAGIMFKGVKSSGKASY 279
            :.|    .:|||.:||..:|||..|:|| |:|.|||.|.|.|...|::|..|:.||::|||||||
  Fly   199 VQG----VSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASY 259

  Fly   280 FLALFPYVVMLVLLVRALTLPGAFDGVLYFLRPQWHKLLEPQVWYAAVTQVFFSLAICFGNIIMY 344
            ||||||||:|:|||:||:|||||:.|::|||:|||.:||.|.|||||:||:|||||||||.::||
  Fly   260 FLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMY 324

  Fly   345 ASYNRFGHNIYRDANIVTTLDTFTSLLSGVIIFGILGNLAYENNTTDIASVVNGGPGLAFISYPD 409
            ||:|.|..|:::|..|:||:|:.||:|:|.||||||||||:|.||.||:.||.||.||||||||:
  Fly   325 ASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPE 389

  Fly   410 AIAKFKWLPQLFSVLFFLMLFVLGIGSNVGMASCMSTVIKDQFGHLKNWTVVVGIAIVGYFLGLL 474
            ||||||:|||||:||||.||.|||||||:||||.:..|:||:|.||.:|.:.|..:|:|:..||:
  Fly   390 AIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHLPHWLLAVSASIIGFLCGLV 454

  Fly   475 YITPGGQFLLNLVDYFGVTFVALVLAIFELVTIAWIYGVKRLCRDVEFMIGIKTSLYYRICWAVV 539
            |:||||||:|||||::|.||:||||||.||:.:.|||||||:|.|:|||:.:|||.|:|||||:|
  Fly   455 YMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRICWAIV 519

  Fly   540 TPLLMLTILIYTLVLYEPLKYKDYTYQSGVYVFGWCLSAFGVGQVLFWAIPAVRKQP-----SHL 599
            .|.||..:|:|.|..||||.|:...|....|:.||.:...||.|:.|||:..:.:||     |..
  Fly   520 APGLMFLVLVYMLFSYEPLTYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIYQQPGKTFGSKF 584

  Fly   600 GLWARIRKAFEPLPNWGPSDPQTLKRYQLFVQEGNANALFRRSSIWHKIYDNIFG 654
            ||      |.:|..||||...|   :::.::......|.| :|.....::|||||
  Fly   585 GL------AMQPTANWGPLQTQ---KFEAYIIHRKREADF-KSPRGGYLFDNIFG 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1698NP_001260835.1 SLC6sbd 75..552 CDD:271359 299/478 (63%)
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 299/478 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130912863
eggNOG 1 0.900 E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11616
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.