DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30082

DIOPT Version :8

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster

Alignment Length:280 Identity:98/281 (35%)
Similarity:136/281 (48%) Gaps:44/281 (16%)


  Fly    40 QLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAA 104
            |....:||...||.|.    .||.|||.:.:.|.||:|:||.:..:.   |.|:|:::.||||||
  Fly    22 QFIDPNCGTTINLPPT----NRIVGGRTADIGSNPWLAYLHKNSSLV---CTGTLITKRFVLTAA 79

  Fly   105 HC---FKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPG-- 164
            ||   |.:      :.|.|||.|.|:..||.:    ..|....||::::...:|    .|:.|  
  Fly    80 HCLHSFHL------LTVRLGEYDTSTRIDCTS----EFCIPTYEEYSVENAYIH----TFFGGRQ 130

  Fly   165 ---YDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVH- 225
               .||.|:|||..||:|..||||||......:.::    .:|.|.|||:.:....|.....|: 
  Fly   131 DSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYS----STYEAAGWGKIDLINTATVLQTVNL 191

  Fly   226 --INTEKCTDGRDTSF----LCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNC- 283
              ::...|.....||.    .||.....|||:|||||||..|.:.....||||.|:||.|...| 
  Fly   192 IRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCR 256

  Fly   284 GAGQKAYYMDVPTYVPWILA 303
            |.|...|   ||::..|||:
  Fly   257 GPGVYTY---VPSFTNWILS 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 90/256 (35%)
Tryp_SPc 62..301 CDD:238113 89/255 (35%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 90/256 (35%)
Tryp_SPc 40..274 CDD:238113 91/259 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.