DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30002

DIOPT Version :8

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster

Alignment Length:310 Identity:268/311 (86%)
Similarity:285/311 (92%) Gaps:0/311 (0%)


  Fly     1 MNSPLGITALIWGILCLSCPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGG 65
            |||||.||||:||||||:|||.|:||.|||||.:.|.||.||||||||.||.|||.|:|..||||
  Fly     1 MNSPLAITALVWGILCLTCPPLSEAGMEDWTPGQRLVYENLTQQDCGVRSNQIPAVRIRFMITGG 65

  Fly    66 RKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSD 130
            |||||:||||||||||:.|:|||||||||:|||||||||||||||||||||||||||||:|||||
  Fly    66 RKSSLMSQPWMAFLHIASDLEMCRCGGSLISELFVLTAAHCFKMCPRSKEIRVWLGELDLSSTSD 130

  Fly   131 CVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLA 195
            |.||||:||||.|||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 CTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLA 195

  Fly   196 FTLQLGQSYMAVGWGRTESRRFANSTMEVHINTEKCTDGRDTSFLCANGDYVDTCTGDSGGPLIW 260
            |||||||.:||||||:|||.|:|||||||.|.|||||||||||||||:|||||||.|||||||:|
  Fly   196 FTLQLGQRFMAVGWGKTESLRYANSTMEVDIRTEKCTDGRDTSFLCASGDYVDTCNGDSGGPLLW 260

  Fly   261 KTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILAKMAELSD 310
            |||||||.|.||||||||||||||||.||||||||||:||||.||||.||
  Fly   261 KTTLFGKDRAVQFGVVSTGSQNCGAGHKAYYMDVPTYMPWILEKMAEFSD 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 216/240 (90%)
Tryp_SPc 62..301 CDD:238113 216/239 (90%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 216/239 (90%)
Tryp_SPc 62..301 CDD:238113 216/239 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131113326
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.