DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and C2

DIOPT Version :8

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_038512.2 Gene:C2 / 12263 MGIID:88226 Length:760 Species:Mus musculus

Alignment Length:378 Identity:91/379 (24%)
Similarity:146/379 (39%) Gaps:104/379 (27%)


  Fly     5 LGITALIWGILCLSCPPSSQAG-REDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITG-GRK 67
            |.|.|:..|.|.:.....::.| ::|...|..:..:....|.  :..:::...:|...|.| |..
Mouse   413 LDIYAIGVGKLDVDWKELNELGSKKDGERHAFILQDAKALQQ--IFEHMLDVSKLTDTICGVGNM 475

  Fly    68 SSLLSQ----PW-MAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGEL-DIS 126
            |:..|.    || :.|...|.:    .|.|||:|:.:||||||||... :.::..:|...: |.:
Mouse   476 SANASDQERTPWQVTFKPKSKE----TCQGSLISDQWVLTAAHCFHDI-QMEDHHLWRVNVGDPT 535

  Fly   127 STSDCVTYNYQRVCALPVEEFTIDKWILHEEFNL----------FYPGYDIALIKLNKKVVFKDH 181
            |...              :||.::..|:...||:          ||.. ||||:||::||....|
Mouse   536 SQHG--------------KEFLVEDVIIAPGFNVHAKRKQGISEFYAD-DIALLKLSRKVKMSTH 585

  Fly   182 IRPICLPLT-------------------DELLA-----------------FTLQLGQSYMAVGWG 210
            .||||||.|                   .|||:                 ..|:.|..:......
Mouse   586 ARPICLPCTVGANMALRRSPGSTCKDHETELLSQQKVPAHFVALNGNRLNINLRTGPEWTRCIQA 650

  Fly   211 RTESRRFANSTMEVHINTEKCTDGRDTSFLCANGDYVD--TCTGDSGGPLIWKTTLFGKARTVQF 273
            .::::....|...|   :|..||    .|||:..:..|  .|.|:|||.:.    |..:.|..|.
Mouse   651 VSQNKNIFPSLTNV---SEVVTD----QFLCSGMEEEDDNPCKGESGGAVF----LGRRYRFFQV 704

  Fly   274 GVVS-------TGSQNCGAGQKA--------YYMDVPTYVPWILAKMAELSDF 311
            |:||       .||.|....:|.        :::.:....||:...:..:.||
Mouse   705 GLVSWGLFDPCHGSSNKNLRKKPPRGVLPRDFHISLFRLQPWLRQHLDGVLDF 757

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 79/310 (25%)
Tryp_SPc 62..301 CDD:238113 79/309 (26%)
C2NP_038512.2 CCP 94..149 CDD:153056
CCP 156..210 CDD:214478
vWFA 260..457 CDD:294047 9/46 (20%)
MIDAS-like motif. {ECO:0000250} 267..271
Tryp_SPc 480..750 CDD:238113 75/301 (25%)
Tryp_SPc 480..721 CDD:214473 72/272 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7585
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.