DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uba1 and Uba7

Sequence 1:NP_477310.2 Gene:Uba1 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_076227.1 Gene:Uba7 MGIID:1349462 Length:977 Species:Mus musculus

Alignment Length:1019 Identity:408/1020 (40%)
Similarity:607/1020 (60%) Gaps:65/1020 (6%)


  Fly   195 IDESLYSRQLYVLGHDAMRRMANSDILLSGLGGLGLEIAKNVILGGVKSITLHDT-ATCGLHDLS 258
            :||.||||||||||..||:|:..:.:||.||.|||.|:|||::|.||.|:||||. .||.. ||:
Mouse     1 MDEELYSRQLYVLGLPAMQRIQEAKVLLCGLQGLGAEVAKNLVLTGVGSLTLHDPHPTCWA-DLA 64

  Fly   259 SQFYLTEADIGKNRAEASCAQLAELNNYVRTVSHTGPLTEEFLRKFRVVVLTNSDGEEQQRIAKF 323
            :|.:|:|..:|:||||||.||||:||..|:...|:|.:||:.|:.|:|||||:|..|:|.::...
Mouse    65 AQCFLSEESLGRNRAEASQAQLAQLNEAVQISVHSGDITEDLLQGFQVVVLTDSKLEDQLKVGPL 129

  Fly   324 AHENGIALIIAETRGLFAKVFCDFGESFTIYDQDGTQPISTMIASITHDAQGVVTCLDET-RHGF 387
            .|::|:..::||||||..::||||||.||:.|....:|::..|..|:....|:||...:| ||.|
Mouse   130 CHKHGVRFLMAETRGLVGRLFCDFGEDFTVLDPTEVEPMTAAIQDISQGFPGIVTLRGDTKRHSF 194

  Fly   388 NDGDYVTFSEVQGMQELNGCQPLKITVLGPYTFSIGDTSKFGEYKSGGVATQVKMPKTISFKPLA 452
            :|||.|.||:::||.|||.|.|..:.|....:..||||:.|..|..|||.|:||.|||:..|||.
Mouse   195 HDGDLVIFSDIEGMVELNSCSPQSVRVQKDGSLEIGDTTTFSRYLRGGVVTEVKRPKTVRHKPLD 259

  Fly   453 QATEEPEFLISDFAKLDSPATLHVAFNALSCYRKAHNGALPRPWNEEDANSF------LEVVRAS 511
            .|..:|..:..:..::.....||.||:.|..:::.| |.||:||:.:||.:.      ||.::.:
Mouse   260 IALLQPHVVAQNTQEVQRAHCLHQAFHVLHKFQQLH-GRLPKPWDPDDAETVVELAQDLEPLKGT 323

  Fly   512 SNAEVDEKLVLQFAKICSGNTCPLDAAVGGIVAQEVLKACSGKFTPIYQWLYFDALECLPTEGV- 575
            ....:||.|:...|...:|...|:.|.:||:.|||||||.|.||.|:.||||||||||||.:.. 
Mouse   324 EEESLDEALLRTIALSSAGTLSPMAAIMGGVAAQEVLKAISRKFMPLDQWLYFDALECLPEDETL 388

  Fly   576 --EEADAQPVGSRYDSQIAIFGKKFQEKLADSKWFIVGAGAIGCELLKNFGMLGLGT-GNGQIFV 637
              ...|.||...|||.|||:||...||||:|..:.:|||||||||:||.|.::|||. .||.:.|
Mouse   389 LPSPEDCQPRNCRYDGQIAVFGTDLQEKLSDQHYLLVGAGAIGCEMLKVFALVGLGVRANGGVTV 453

  Fly   638 TDMDLIEKSNLNRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETEKVFSEDFFGK 702
            .|||.||:|||:|||||||.||::||:..||.|..|:||::..|.|...:...||.::.:.||.:
Mouse   454 ADMDYIERSNLSRQFLFRPKDVRRPKAEVAAAAAHRLNPDLRATPYTCPLDPTTEDIYDDSFFSR 518

  Fly   703 LDGVANALDNVDARIYMDRKCIFNRIPLVETGTLGTLGNVQVIVPFATESY------SSSQDPPE 761
            ::||..|||:..||.|:..:|.....||:|.||.||.|:..|.||:.||:|      ::|:|.| 
Mouse   519 VNGVVAALDSFQARHYVAARCTHYLKPLLEAGTQGTWGSASVFVPYVTEAYRGPASDAASEDAP- 582

  Fly   762 KSIPICTLKNFPNAIEHTLQWARDAFEGVFKQSAENAAQYIADPQFTERIAKLPGIQPLEILDSI 826
              .|:|||::.|:::||::|||:|.|||:|:.|.|....|   .|....::.....:.|.:|..:
Mouse   583 --YPVCTLRHIPSSMEHSVQWAQDQFEGLFRLSTETINCY---QQTCTSLSATDRTETLALLQQV 642

  Fly   827 KKALIDDKPKSFAHCVEWARLYWEDQYVNQIKQLLFNFPPDQITSSGQPFWSGPKRCPDPLVFDV 891
             ..::..:|:::..||.||..:|         ||.|:   |::...|..|.||..:||.||.||.
Mouse   643 -MGVLRTRPQTWQDCVVWALGHW---------QLCFH---DKVLEGGTQFSSGSNKCPHPLQFDP 694

  Fly   892 NDPMHLDFIYAAANLRAEVYGIEQVRNRETIAELVQKVKVPEFKPRSGVKIETNEAAAAASANNF 956
            |..||..::.|||||.|.::|:...:::..:.||:.::...:.:|:                 |.
Mouse   695 NHDMHFLYVLAAANLYARMHGLPGSQSQPALRELLTRLLESDSRPQ-----------------NL 742

  Fly   957 DDGELDQDRVDKIISELLKNADKSSKITPLEFEKDDDSNLHMDFIVACSNLRAANYKIPPADRHK 1021
            ...|..|::: |.:.|.|.:..|...:.|:.|.||||||.|:||:||.::||..||.|.|.:..:
Mouse   743 FSAEHGQEQL-KELQETLDDWRKGPPLKPVLFVKDDDSNFHVDFVVAATDLRCQNYGILPVNHAR 806

  Fly  1022 SKLIAGKIIPAIATTTSVLSGLAVLEVIKLIVGHRDLVKFKNGFANLALPFMAFSEPLPAAKNTY 1086
            .|.|.|:|||||||:|:|::||..||:.|::.|.|....|::.:.:||......|.|...|..::
Mouse   807 IKQIVGRIIPAIATSTAVVAGLLGLELYKVVSGLRSHGTFRHSYLHLAENHFIRSAPSAPAVQSF 871

  Fly  1087 YGKEWTLWDRFEVTG---ELSLQEFLNYFEENEKLKITMLSQGVSMLYSFFMPKAKCSERLPLPM 1148
            ...:||.|||.:|..   |.:|:..|.:.:|...||:.||....::|||......|.::.|.|.:
Mouse   872 RDLKWTCWDRLKVPAVQPERTLKSLLAHLQEEHGLKVEMLLHHQALLYSSGWSSEKQAQHLCLRV 936

  Fly  1149 SEVVRRVSKRRLEPHERSLVFEICCNDVDGEDVEV--PYVRYTL 1190
            :|:|:.|:..:.:|..:.||||:.|   :||:.|:  |.:.|.|
Mouse   937 TELVQHVTGWKPKPGLKVLVFELSC---EGEEEEMAFPPLHYEL 977

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 406/1016 (40%)
Ube1_repeat1 199..574 CDD:238768 175/383 (46%)
E1_4HB 447..510 CDD:292809 20/69 (29%)
Ube1_repeat2 606..1144 CDD:238767 198/548 (36%)
Uba7NP_076227.1 Ube1 1..961 CDD:273603 401/999 (40%)
Ube1_repeat1 5..386 CDD:238768 175/383 (46%)
E1_4HB 254..317 CDD:292809 18/64 (28%)
E1_enzyme_family 421..932 CDD:304554 198/548 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D139631at33208
OrthoFinder 1 1.000 FOG0000593
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127070
Panther 1 1.100 LDO PTHR10953
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.780

Return to query results.
Submit another query.