DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT1 and GstD2

Sequence 1:NP_610509.2 Gene:GstT1 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:214 Identity:55/215 (26%)
Similarity:102/215 (47%) Gaps:32/215 (15%)


  Fly    10 DFLSQPS-----RALWIAMKLGKTPFEDCPVALRKQ-------EQLTDEYRSINRFQKVPAIVDG 62
            ||...|.     ..:.:|..||        :.|.|:       |||..|:..:|....:|.:||.
  Fly     2 DFYYMPGGGGCRTVIMVAKALG--------LELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDN 58

  Fly    63 KFQLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGL 127
            .|.:.||.:|..||.:|....:.|.|...::||.:::.|   :|::..:...|.:..:.|...| 
  Fly    59 GFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRL---YFDMGTLYESFAKYYYPLFRTG- 119

  Fly   128 APAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFP 192
                ||.|.:.| |.:|:..|.|:.....::::.||:||||||...|.::..::.:::.:  ::.
  Fly   120 ----KPGSDEDL-KRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFS--KYS 177

  Fly   193 KVAKWMERVRDATNPYYDE 211
            .|::|.:..:..| |.:||
  Fly   178 NVSRWYDNAKKVT-PGWDE 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 51/206 (25%)
GST_N_Theta 5..80 CDD:239348 23/82 (28%)
GST_C_Theta 93..218 CDD:198292 30/120 (25%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/80 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95550202
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.