DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstD2

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:214 Identity:55/214 - (25%)
Similarity:102/214 - (47%) Gaps:32/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DFLSQPS-----RALWIAMKLGKTPFEDCPVALRKQ-------EQLTDEYRSINRFQKVPAIVDG 62
            ||...|.     ..:.:|..||        :.|.|:       |||..|:..:|....:|.:||.
  Fly     2 DFYYMPGGGGCRTVIMVAKALG--------LELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDN 58

  Fly    63 KFQLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGL 127
            .|.:.||.:|..||.:|....:.|.|...::||.:::.|   :|::..:...|.:..:.|...| 
  Fly    59 GFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRL---YFDMGTLYESFAKYYYPLFRTG- 119

  Fly   128 APAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFP 192
                ||.|.:.| |.:|:..|.|:.....::::.||:||||||...|.::..::.:::.:  ::.
  Fly   120 ----KPGSDEDL-KRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFS--KYS 177

  Fly   193 KVAKWMERVRDATNPYYDE 211
            .|::|.:..:..| |.:||
  Fly   178 NVSRWYDNAKKVT-PGWDE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 51/205 (25%)
GST_N_Theta 5..80 CDD:239348 22/81 (27%)
GST_C_Theta 93..218 CDD:198292 30/119 (25%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/79 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/120 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.