DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT1 and GstE3

Sequence 1:NP_610509.2 Gene:GstT1 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster

Alignment Length:218 Identity:64/219 (29%)
Similarity:110/219 (50%) Gaps:22/219 (10%)


  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQ 65
            |.|...|..|. |.|.|::.:.::.....|:...|.|.::|.|..|:..||....|||:.|..|.
  Fly     1 MGKLTLYGIDG-SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFY 64

  Fly    66 LGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCS----LFFRQVWLLPAKG 126
            |.:|.:|..||..|...::.||||.|::||.||:.|   |::..:|.|    :.|...|  ..|.
  Fly    65 LADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRL---HYDSSVVTSTGRAITFPLFW--ENKT 124

  Fly   127 LAPAPKPESVKKLIKDVESNLGLLERLWLEK-DFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQ 190
            ..|..:.::::.:.|.:        .|:||. ::|.||.||:||....:.:... .....|:..:
  Fly   125 EIPQARIDALEGVYKSL--------NLFLENGNYLAGDNLTIADFHVIAGLTGF-FVFLPVDATK 180

  Fly   191 FPKVAKWMERVRDATNPYYDEAH 213
            :|::|.|::|:::.  |||:||:
  Fly   181 YPELAAWIKRIKEL--PYYEEAN 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 57/204 (28%)
GST_N_Theta 5..80 CDD:239348 24/75 (32%)
GST_C_Theta 93..218 CDD:198292 33/127 (26%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 57/208 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/74 (31%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92091923
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_127168
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.