DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Updo and HEM12

DIOPT Version :8

Sequence 1:NP_610501.1 Gene:Updo / 35986 FlyBaseID:FBgn0033428 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_010332.3 Gene:HEM12 / 851617 SGDID:S000002454 Length:362 Species:Saccharomyces cerevisiae

Alignment Length:355 Identity:170/356 (48%)
Similarity:227/356 (64%) Gaps:7/356 (2%)


  Fly     7 FPVLKNDNLLRAARGEVVDRVPVWVMRQAGRYLPEFQELRKHHDFFTVCRTPELACEVTMQPLRR 71
            ||..|||.:||||:||.|:|.|.|:||||||||||:.|::.:.|||..||..|:|.|:|:||:||
Yeast     4 FPAPKNDLILRAAKGEKVERPPCWIMRQAGRYLPEYHEVKNNRDFFQTCRDAEIASEITIQPVRR 68

  Fly    72 FD--LDASIIFSDILVIPQALGLTVEMHAGVGPVLPQPIVVPEDLKRLT--PDGALSRLSYVGDA 132
            :.  :||:||||||||||||:|:.|||..|.||..|:|:..||||:.:.  ....|..|.:...|
Yeast    69 YRGLIDAAIIFSDILVIPQAMGMRVEMLEGKGPHFPEPLRNPEDLQTVLDYKVDVLKELDWAFKA 133

  Fly   133 ITMMRHKLEGRVPLIGFTGAPWTLMGYMIEGGGSKTMSKAKAWLNEHPEDSKLFLNLLTDAIVDY 197
            |||.|.||:|.|||.||.|.|||||.||.|||||:....||.|:|.:||.|...|..:||..|::
Yeast   134 ITMTRIKLDGEVPLFGFCGGPWTLMVYMTEGGGSRLFRFAKQWINMYPELSHKLLQKITDVAVEF 198

  Fly   198 LEMQVKAGAQMLQVFESSAEHLSKEQFLQWCVPYLKRIRDELVDRLTKKAI-PVVPMTLFAKGAG 261
            |..||.||||:||||||....||...|.::.:|||::|.:.:..||.:..| ..:||.:||||:.
Yeast   199 LSQQVVAGAQILQVFESWGGELSSVDFDEFSLPYLRQIAERVPKRLQELGIMEQIPMIVFAKGSW 263

  Fly   262 HSLKEQSELGYDVIGLDWTVDPLEARNLVGPNITLQGNLDPQDMYRDPDELRNLTTEMVHKF--G 324
            ::|.:....|:||:.|||:.||.||..:....:||||||||..||...:.:.....:|:..|  |
Yeast   264 YALDKLCCSGFDVVSLDWSWDPREAVKINKNRVTLQGNLDPGVMYGSKEVITKKVKQMIEAFGGG 328

  Fly   325 KSRYIANLGHGITPQTPITSMEVLVEAVHK 354
            |||||.|.|||..|......::..:|..|:
Yeast   329 KSRYIVNFGHGTHPFMDPDVIKFFLEECHR 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UpdoNP_610501.1 hemE 14..354 CDD:273640 165/347 (48%)
HEM12NP_010332.3 URO-D 13..358 CDD:238368 165/345 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153991301
eggNOG 1 0.900 E1_COG0407
Hieranoid 1 1.000
Homologene 1 1.000 H320
Inparanoid 1 1.050 317 1.000 Inparanoid score I454
Isobase 1 0.950 0 Normalized mean entropy S855
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004430
OrthoInspector 1 1.000 T1136173
orthoMCL 1 0.900 OOG5_127347
Panther 1 1.100 LDO PTHR21091
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R302
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.