DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urod and HEME2

DIOPT Version :9

Sequence 1:NP_610501.1 Gene:Urod / 35986 FlyBaseID:FBgn0033428 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_181581.1 Gene:HEME2 / 818644 AraportID:AT2G40490 Length:394 Species:Arabidopsis thaliana


Alignment Length:331 Identity:120/331 - (36%)
Similarity:190/331 - (57%) Gaps:12/331 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLRAARGEVVDRVPVWVMRQAGRYLPEFQEL-RKHHDFFTVCRTPELACEVTMQPLRRFDLDASI 78
            ||||.:||||||.|||:|||||||:..:|.| .|:..|.......:|..|:::||.:.|..|..|
plant    56 LLRAVKGEVVDRPPVWLMRQAGRYMKSYQTLCEKYPSFRDRSENADLVVEISLQPWKVFKPDGVI 120

  Fly    79 IFSDILVIPQALGLTVEMHAGVGPVL---PQPIVVPEDLKRLTPDGALSRLSYVGDAITMMRHKL 140
            :|||||.....:.:..::..|.||::   ||.......::...|:   ..:.|||:|:..:|:::
plant   121 LFSDILTPLSGMNIPFDIVKGKGPIIFNPPQSAADVAQVREFVPE---ESVPYVGEALRRLRNEV 182

  Fly   141 EGRVPLIGFTGAPWTLMGYMIEGGGSKTMSKAKAWLNEHPEDSKLFLNLLTDAIVDYLEMQVKAG 205
            .....::||.|||:||..|:||||.||..::.|......|:.....|...|.:::.|:..|..:|
plant   183 NNEAAVLGFVGAPFTLSSYVIEGGSSKNFTQIKRLAFSQPKVLHALLQKFTTSMITYIRYQADSG 247

  Fly   206 AQMLQVFESSAEHLSKEQFLQWCVPYLKRIRDELVDRLTKKAIPVVPMTLFAKGAGHSLKEQSEL 270
            ||.:|:|:|.|..||...|.::.:||||:|.:.:     |:..|.:|:.|:|.|:|..|:..:..
plant   248 AQAVQIFDSWATELSPVDFEEFSLPYLKQIVEAV-----KQTHPNLPLILYASGSGGLLERLART 307

  Fly   271 GYDVIGLDWTVDPLEARNLVGPNITLQGNLDPQDMYRDPDELRNLTTEMVHKFGKSRYIANLGHG 335
            |.||:.||||||..|.|:.:|.:|.:|||:||..::...:.:.:...:.|.|.|:.::|.|||||
plant   308 GVDVVSLDWTVDMAEGRDRLGRDIAVQGNVDPGVLFGSKEFITSRIHDTVKKAGRDKHILNLGHG 372

  Fly   336 ITPQTP 341
            |...||
plant   373 IKVGTP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UrodNP_610501.1 hemE 14..354 CDD:273640 120/331 (36%)
HEME2NP_181581.1 PLN02433 56..394 CDD:215237 120/331 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 222 1.000 Domainoid score I709
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H320
Inparanoid 1 1.050 222 1.000 Inparanoid score I1198
OMA 1 1.010 - - QHG54670
OrthoDB 1 1.010 - - D1114675at2759
OrthoFinder 1 1.000 - - FOG0003767
OrthoInspector 1 1.000 - - otm3514
orthoMCL 1 0.900 - - OOG6_100829
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2624
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.