DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Updo and urod

DIOPT Version :8

Sequence 1:NP_610501.1 Gene:Updo / 35986 FlyBaseID:FBgn0033428 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_571422.1 Gene:urod / 30617 ZFINID:ZDB-GENE-000208-18 Length:369 Species:Danio rerio

Alignment Length:357 Identity:192/358 (54%)
Similarity:243/358 (68%) Gaps:5/358 (1%)


  Fly     2 KDA----KPFPVLKNDNLLRAARGEVVDRVPVWVMRQAGRYLPEFQELRKHHDFFTVCRTPELAC 62
            ||:    |.||.|:||..|||||||.::.:|||.|||||||||||:|.|...|||..||:||..|
Zfish     4 KDSFILPKDFPELRNDTFLRAARGEEIEHIPVWCMRQAGRYLPEFRESRAGKDFFETCRSPEACC 68

  Fly    63 EVTMQPLRRFDLDASIIFSDILVIPQALGLTVEMHAGVGPVLPQPIVVPEDLKRL-TPDGALSRL 126
            |:|:||||||..||:||||||||:|||:|:.|:|..|.||..|:|:..||||:|| |.....|.|
Zfish    69 ELTLQPLRRFPFDAAIIFSDILVVPQAMGMEVQMCPGKGPTFPEPLKEPEDLQRLKTQVDVYSEL 133

  Fly   127 SYVGDAITMMRHKLEGRVPLIGFTGAPWTLMGYMIEGGGSKTMSKAKAWLNEHPEDSKLFLNLLT 191
            .||..|||:.|||:||:||||||||||||||.||||||||.|.||||.||..:||.|...|:.||
Zfish   134 DYVFKAITLTRHKIEGKVPLIGFTGAPWTLMSYMIEGGGSATHSKAKRWLYRYPEASHKLLSQLT 198

  Fly   192 DAIVDYLEMQVKAGAQMLQVFESSAEHLSKEQFLQWCVPYLKRIRDELVDRLTKKAIPVVPMTLF 256
            |.||:||..|||||||.||||||....|...:|.::.:|||:.|...:.|::.:..:..|||.:|
Zfish   199 DVIVEYLLGQVKAGAQALQVFESHTGCLGPVEFKEFSLPYLRDIARRVKDKIKESGLDNVPMIVF 263

  Fly   257 AKGAGHSLKEQSELGYDVIGLDWTVDPLEARNLVGPNITLQGNLDPQDMYRDPDELRNLTTEMVH 321
            ||...:.|::.||..|:|:|||||:||..||...|..::||||:||..:|...:.:..:...|:.
Zfish   264 AKDGHYGLEDLSESAYEVVGLDWTIDPRSARVRTGGKVSLQGNMDPCALYGTKESISEIVRRMLE 328

  Fly   322 KFGKSRYIANLGHGITPQTPITSMEVLVEAVH 353
            .||...||||||||:.|.....::...|||||
Zfish   329 GFGTKGYIANLGHGLYPDMDPENVGAFVEAVH 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UpdoNP_610501.1 hemE 14..354 CDD:273640 184/342 (54%)
urodNP_571422.1 URO-D 22..361 CDD:238368 184/340 (54%)
Substrate binding. {ECO:0000250} 39..43 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153985008
eggNOG 1 0.900 E1_COG0407
Hieranoid 1 1.000
Homologene 1 1.000 H320
Inparanoid 1 1.050 380 1.000 Inparanoid score I1975
OMA 1 1.010
OrthoDB 1 1.010 D1114675at2759
OrthoFinder 1 1.000 FOG0004430
OrthoInspector 1 1.000 T1052938
orthoMCL 1 0.900 OOG5_127347
Panther 1 1.100 LDO PTHR21091
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R302
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.