DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Updo and Urod

DIOPT Version :8

Sequence 1:NP_610501.1 Gene:Updo / 35986 FlyBaseID:FBgn0033428 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_033504.2 Gene:Urod / 22275 MGIID:98916 Length:367 Species:Mus musculus

Alignment Length:349 Identity:190/350 (54%)
Similarity:236/350 (67%) Gaps:1/350 (0%)


  Fly     7 FPVLKNDNLLRAARGEVVDRVPVWVMRQAGRYLPEFQELRKHHDFFTVCRTPELACEVTMQPLRR 71
            ||.||||..||||.||..|..|||.|||||||||||:|.|...|||:.||:||..||:|:|||||
Mouse    11 FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRR 75

  Fly    72 FDLDASIIFSDILVIPQALGLTVEMHAGVGPVLPQPIVVPEDLKRL-TPDGALSRLSYVGDAITM 135
            |.|||:||||||||:|||||:.|.|..|.||..|:|:....||:|| .|..|.|.|.||..|||:
Mouse    76 FPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLERLRDPAAAASELGYVFQAITL 140

  Fly   136 MRHKLEGRVPLIGFTGAPWTLMGYMIEGGGSKTMSKAKAWLNEHPEDSKLFLNLLTDAIVDYLEM 200
            .|.:|.||||||||.|||||||.||:|||.|.||::||.||.:.|:.|...|.:|||.:|.||..
Mouse   141 TRQRLAGRVPLIGFAGAPWTLMTYMVEGGSSSTMAQAKRWLYQRPQASHKLLGILTDVLVPYLIG 205

  Fly   201 QVKAGAQMLQVFESSAEHLSKEQFLQWCVPYLKRIRDELVDRLTKKAIPVVPMTLFAKGAGHSLK 265
            ||.||||.||:|||.|.||..|.|.::.:||::.:...:...|.|..:..|||.:|||....:|:
Mouse   206 QVAAGAQALQLFESHAGHLGTELFSKFALPYIRDVAKRVKAGLQKAGLAPVPMIIFAKDGHFALE 270

  Fly   266 EQSELGYDVIGLDWTVDPLEARNLVGPNITLQGNLDPQDMYRDPDELRNLTTEMVHKFGKSRYIA 330
            |.::.||:|:||||||.|.:||..||..:||||||||..:|...:|:..|..:|:..||..||||
Mouse   271 ELAQAGYEVVGLDWTVAPKKARERVGKAVTLQGNLDPCALYASEEEIGRLVQQMLDDFGPQRYIA 335

  Fly   331 NLGHGITPQTPITSMEVLVEAVHK 354
            |||||:.|......:...|:||||
Mouse   336 NLGHGLYPDMDPERVGAFVDAVHK 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UpdoNP_610501.1 hemE 14..354 CDD:273640 183/341 (54%)
UrodNP_033504.2 URO-D 20..359 CDD:238368 183/339 (54%)
Substrate binding. {ECO:0000250} 37..41 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153985091
eggNOG 1 0.900 E1_COG0407
Hieranoid 1 1.000
Homologene 1 1.000 H320
Inparanoid 1 1.050 374 1.000 Inparanoid score I2078
Isobase 1 0.950 0 Normalized mean entropy S855
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004430
OrthoInspector 1 1.000 T1083715
orthoMCL 1 0.900 OOG5_127347
Panther 1 1.100 LDO PTHR21091
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R302
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.