DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Updo and LOC101734235

DIOPT Version :8

Sequence 1:NP_610501.1 Gene:Updo / 35986 FlyBaseID:FBgn0033428 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_017948684.1 Gene:LOC101734235 / 101734235 -ID:- Length:256 Species:Xenopus tropicalis

Alignment Length:242 Identity:138/243 (57%)
Similarity:171/243 (70%) Gaps:1/243 (0%)


  Fly    66 MQPLRRFDLDASIIFSDILVIPQALGLTVEMHAGVGPVLPQPIVVPEDLKRLTPDGALS-RLSYV 129
            |.|||||.|||:||||||||||||||:.:.|..|.|||.|:|:..|:||.:|.....:| .|.||
 Frog     4 MHPLRRFPLDAAIIFSDILVIPQALGMEIRMEPGRGPVFPEPLQTPQDLHKLRSSVDVSEELGYV 68

  Fly   130 GDAITMMRHKLEGRVPLIGFTGAPWTLMGYMIEGGGSKTMSKAKAWLNEHPEDSKLFLNLLTDAI 194
            ..|||:.|||:||:||||||||||||||.||||||||.||||||.||.:||..|...|..|||.|
 Frog    69 FHAITLTRHKIEGKVPLIGFTGAPWTLMTYMIEGGGSNTMSKAKRWLYQHPSASHQLLKQLTDVI 133

  Fly   195 VDYLEMQVKAGAQMLQVFESSAEHLSKEQFLQWCVPYLKRIRDELVDRLTKKAIPVVPMTLFAKG 259
            |:||..||.||||.||||||.|..|..:||..:.:|||:.|...:..:|..:.:..|||.:|||.
 Frog   134 VEYLVGQVAAGAQALQVFESHAGCLGPQQFSDFSLPYLRDISRRVKHKLKAEGLDQVPMIVFAKD 198

  Fly   260 AGHSLKEQSELGYDVIGLDWTVDPLEARNLVGPNITLQGNLDPQDMY 306
            |.::|::.|:.||:|:|||||:.|.|||...|..:|||||:||..:|
 Frog   199 AHYALEDLSQSGYEVVGLDWTIRPQEARERTGKRVTLQGNMDPCALY 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UpdoNP_610501.1 hemE 14..354 CDD:273640 138/243 (57%)
LOC101734235XP_017948684.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1114675at2759
OrthoFinder 1 1.000 FOG0004430
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.