DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and ZMYND15

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001254751.1 Gene:ZMYND15 HGNCID:20997 Length:750 Species:Homo sapiens

Alignment Length:471 Identity:88/472 (19%)
Similarity:131/472 (28%) Gaps:219/472 (46%)


  Fly   258 CQQCAATLMSAPI-PCPNCHQRVVYCSRKCREA------HSAIHKFECAAYRKDILRLLGISHLA 315
            |..|......|.: |||.| ..|:||...|..|      ....|:|.|.       ||......|
Human   313 CHVCHRHSFEAKLTPCPQC-SAVLYCGEACLRADWQRCPDDVSHRFWCP-------RLAAFMERA 369

  Fly   316 LRLLLTYIPYIRPHLQEMTS--------------AKGMWEEIMNL------SRKPEESENAPEYL 360
            ..  |..:|:  .:..|:||              .:|.|.::..|      ||.|..:..:...|
Human   370 GE--LATLPF--TYTAEVTSETFNKEAFLASRGLTRGYWTQLSMLIPGPGFSRHPRGNTPSLSLL 430

  Fly   361 R-----------------------------------SLRMVSQLDQAIDEELNYHILCANLLQLY 390
            |                                   :.|.:| ||..|...|.|.:         
Human   431 RGGDPYQLLQGDGTALMPPVPPHPPRGVFGSWQDYYTWRGLS-LDSPIAVLLTYPL--------- 485

  Fly   391 LKEHTDFYDQFHSLPASIED--------------------------WQLII----SALILRFAGQ 425
                |.:|...|.:|.|..:                          |:|::    .||.|:|   
Human   486 ----TVYYVITHLVPQSFPELNIQNKQSLKIHVVEAGKEFDLVMVFWELLVLLPHVALELQF--- 543

  Fly   426 LLANGHVGDAL---------------LGVGMEPKEFVMLQP---------------ELWQKPRHL 460
                  |||.|               |.|.:.|...:..:|               ::..:|.||
Human   544 ------VGDGLPPESDEQHFTLQRDSLEVSVRPGSGISARPSSGTKEKGGRRDLQIKVSARPYHL 602

  Fly   461 KRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYR 525
            .:|...:|..:.|                 .|:...|:.    .:|.||             .:.
Human   603 FQGPKPDLVIASP-----------------SSLSAGFNS----GFALKD-------------TWL 633

  Fly   526 NSLKLQRSHPLKAIY----KFEC-----TCAKCT--RTDPDQNYLSFHRYRCEKPN-CRQEFLPD 578
            .||...:|..:.|.:    ::.|     |.|..|  .|.|.|            || .|..|  .
Human   634 RSLPRLQSLRVPAFFTESSEYSCVMDGQTMAVATGGGTSPPQ------------PNPFRSPF--R 684

  Fly   579 AKVQQNNLRWWLRCNA 594
            .:...|.:.|:  |||
Human   685 LRAADNCMSWY--CNA 698

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 14/47 (30%)
SET <447..526 CDD:214614 12/94 (13%)
ZMYND15NP_001254751.1 zf-MYND 313..359 CDD:280009 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56465891
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.