DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and TPR9

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001321056.1 Gene:TPR9 AraportID:AT1G33400 Length:810 Species:Arabidopsis thaliana

Alignment Length:841 Identity:174/842 (21%)
Similarity:271/842 (32%) Gaps:309/842 (37%)


  Fly    39 LQI-FQKLALDL------LQDLEQPVDRKGCA----ERSKNLREEGNLMFKESASGSSKDSVLKA 92
            ||: |..|:..|      :.:|..|  ..||.    |.|.:|:..||..|:      |:| ..:|
plant    39 LQLNFSSLSFSLVLLSQAVSELANP--ELGCCGKNEETSLDLKRRGNHCFR------SRD-FDEA 94

  Fly    93 CRLYSEAVFEAE-NAVEE----LSLAFANRGIALQEYGYYREAYDDCSNALECG--YPERLRHKV 150
            .||||:|:..|. :|::.    |:..|.||...|...|..:|:..||..||...  |.:      
plant    95 LRLYSKALRVAPLDAIDGDKSLLASLFLNRANVLHNLGLLKESLRDCHRALRIDPYYAK------ 153

  Fly   151 IMRQAFCAW----KLKKIASLEEHLDYLGQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVV 211
                   ||    ||..:  |..:.|....:.:..|.|..|...||....||..|..|..|....
plant   154 -------AWYRRGKLNTL--LGNYKDAFRDITVSMSLESSLVGKKQLQNELKAIPDYQNNQTLEH 209

  Fly   212 DKSLGEILTDPG-------------------PRGRYMVAKEAISKGNVIFSER-------ASCFV 250
            |:....  .|.|                   .:||.||::..|.:.:||..|.       .||  
plant   210 DEYRPS--NDAGVDHLPSVQMEVKLRCVSTKEKGRGMVSECDIEEASVIHVEEPFSVVISKSC-- 270

  Fly   251 PLEQLLICQQCAATLMSAPIPCPNCHQRVVYCSRKCR------------EAHSAIHKFECAAYRK 303
               :...|..|...|.:..:|||:| ...||||..|:            :.|....|..     .
plant   271 ---RETHCHFCLNELPADTVPCPSC-SIPVYCSESCQIQSGGMLSTNEMDKHHIFQKLP-----D 326

  Fly   304 DIL-RLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWE---------------EIMNLSRKPEE 352
            ||: .:.|::...:....|.:  |:.|..|...|.  |.               :::|..:...:
plant   327 DIVEHIKGVTSADIYYFATDL--IQEHQHECRGAN--WPAVLPSDAVLAGRIIMKLINQGKAATD 387

  Fly   353 SENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLP------ASIEDW 411
            ..|..|.|......|:::.  :.:|..|:|...|:....|.         |.|      ||:...
plant   388 LSNLQEILELSHTYSKMNP--ENKLELHLLSIVLIWCLSKS---------SCPNLSVCEASVTQT 441

  Fly   412 QLIISALILRFAGQLLANG-------HVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLS 469
            .:::|        |:..|.       ..||:.                     :.|..|   |:|
plant   442 IILLS--------QIKVNSIAVARMKSSGDSF---------------------KCLPSG---NIS 474

  Fly   470 HSDPITAINLPYL--------SLCNHACEPSIRTKF--------------DGCSVVNYAAKDILE 512
            ..:||.::....:        ||.||:|:|:|...|              .||.:      ::..
plant   475 TKEPIQSLEQIRVGQALYKTGSLFNHSCKPNIHLYFLSRGLIMQTTEFVPTGCPL------ELSY 533

  Fly   513 GEEIFNCYTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLP 577
            |.|:..   .|.:|.::.     |:..|.|.|.|..|.:.:...  |..:.|.|...||....| 
plant   534 GPEVGK---WDCKNRIRF-----LEEEYFFHCRCRGCAQINISD--LVINGYGCVNTNCTGVVL- 587

  Fly   578 DAKVQQNNLRWWLRCNAEKPITCTVCHELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWL 642
            |:.|        ..|.:||         |.||                      |.|..::|   
plant   588 DSNV--------ATCESEK---------LNHF----------------------FTAPRNVD--- 610

  Fly   643 VDHHSLKRIMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQLE----------GIAAQCG--- 694
                  :::...|.|                 |.|:..:....|.          .|..:||   
plant   611 ------QQVQMREKV-----------------YADVGEVASSLLSKPSGSLHIEPEICLKCGSRC 652

  Fly   695 --DNSTEYIARMTYLWDIIAQKKCRTDRKELLEMKGKVDY--LASEHREV-----FLNYYN 746
              :||.   |.:...|:       ...|.|.|...|:.:|  |:...|.:     ||:.||
plant   653 DIENSH---AEVNKAWN-------HMRRVEELMNSGRANYSVLSDCSRSIAVLRTFLHMYN 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 14/52 (27%)
SET <447..526 CDD:214614 19/101 (19%)
TPR9NP_001321056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1278034at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.