DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and smyd4

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_012812690.1 Gene:smyd4 XenbaseID:XB-GENE-945037 Length:777 Species:Xenopus tropicalis

Alignment Length:770 Identity:181/771 (23%)
Similarity:292/771 (38%) Gaps:164/771 (21%)


  Fly     1 MERLARTFSQQNELI--TLNENYKDEFETFKSLASMPADILQIFQKLALDLLQDLEQPVDRKGC- 62
            ||...:.:..|.:.|  .|..:.|::|.:.       ||:.:|||.....|.||.||.::|..| 
 Frog    39 MEHPVQEWQDQAQSIWAHLTSSEKEKFSSI-------ADLDEIFQACLSHLQQDEEQLIERLCCN 96

  Fly    63 --AERSKN----LREEGNLMFKESASGSSKDSVLKACRLYSEAVFEAENAVEELSLAFANRGIAL 121
              ..:..|    .:||||..|.|....:       |..|||:|:..|::..|.|::.||||..||
 Frog    97 VTVAKDPNAVQFFKEEGNKRFAEKQYAT-------AAGLYSKAISHAKSGSEALAVCFANRSAAL 154

  Fly   122 QEYGYYREAYDDCSNALECGYPERLRHKVIMRQAFCAWKLKKIASLEEHLDYLGQLQLKESFEQQ 186
            ...|.|....:|..:|.:.|||||||:|::.|:|.|..:|:|.:|.:..|:.:..::.|:..:..
 Frog   155 FYLGQYSVCLEDIQHAQDHGYPERLRNKILQRKAECFQRLRKPSSCDPKLECVETVKPKKEPQTS 219

  Fly   187 LEDLKQKLELLKNQPREQETQGKVVDKSLGEILTDPGPRGRYMVAKEAISKGNVIFSER--ASCF 249
            .|.||:.  .|...|.       :.:.|....|.....:||:::|.:.|.:|.|:..|.  ||..
 Frog   220 TERLKEM--ALDRNPH-------ITNASCALHLNFDTRKGRHLLASQNIEQGEVLIWEEAFASVI 275

  Fly   250 VPLEQLL---------------ICQQCAATLMSAPIPCPNCHQRVVYCSRKCRE-AHSAIHKFEC 298
            :|..:..               .|..|...:: |.:||..| ....|||::|.: |..:.|..||
 Frog   276 IPERKQWRKEIKWDTRITACDHYCHYCLNRVI-ASLPCQYC-SFARYCSQECMDKAWRSYHYIEC 338

  Fly   299 AAYRKDILRLLGI-SHLALR-LLLTYIPYIRPHLQEMTSAK-------------------GMWEE 342
            :  ..|:|..||: .|.||| :|:.........|::..||.                   ..::.
 Frog   339 S--MGDLLLALGMFCHTALRAVLVAGCRLFSQSLEQTGSADATDKTKVCNSKNTYHEKYCSSYQS 401

  Fly   343 IMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPAS 407
            ::||....|......::|..|...:.          |..||..:.:..:...:...........:
 Frog   402 VVNLLPHTENHPAERKFLCGLTAAAL----------YKKLCLIMAKDLVSSTSQTEKSLTKESGT 456

  Fly   408 IEDWQLI---ISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLS 469
            ||||..:   :...:||...||..|.....||                  |:........|...:
 Frog   457 IEDWSSVRQFLGPTVLRHMLQLYCNAQAVTAL------------------QENEDESSLSLVKSN 503

  Fly   470 HSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCY-----TMDYRNSLK 529
            .|..:.....|.|||.||:|:|:....|.|..|...|.:.|...||:.:||     .||.     
 Frog   504 KSIRLATAVFPVLSLLNHSCDPNTTVSFTGRFVTVRANRPIRRDEEVTHCYGPHKLRMDV----- 563

  Fly   530 LQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNA 594
            .:|...||..|.|.|.|..||.   :......|.:.|  |.|:.:.                 ..
 Frog   564 AERQQLLKDQYFFVCQCKACTE---ELKGKKTHGFFC--PLCKAQL-----------------EG 606

  Fly   595 EKPITCT------VCHELQHFAWYNEFLG---------LIGSSADSSKRQALFKAFDDLDKWLVD 644
            |:.:.||      ...:.|..:..|: ||         |..:..|::| ..|.....:.:.:|..
 Frog   607 EEALYCTGARCTYTASQTQLTSRLNQ-LGNHIQIAKVQLQDNKTDNAK-MTLMSCLSEAECFLSQ 669

  Fly   645 HHSLKRIMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQLEGIAAQCGDNSTE 699
            .|.|...:.:.|..|   |...|      .::..|..:||.:..:....|.:|.|
 Frog   670 DHLLLGEIMDHLAQA---EASDG------NWKAAAGHLRKSISIVKVHYGSSSME 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 13/41 (32%)
SET <447..526 CDD:214614 22/84 (26%)
smyd4XP_012812690.1 TPR repeat 106..134 CDD:276809 11/35 (31%)
TPR_11 107..170 CDD:290150 23/70 (33%)
TPR repeat 143..173 CDD:276809 11/30 (37%)
zf-MYND 299..338 CDD:280009 13/41 (32%)
SET <509..555 CDD:279228 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56188408
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1278034at2759
OrthoFinder 1 1.000 FOG0002920
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5130
TreeFam 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.