DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and smyd4

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001070062.1 Gene:smyd4 ZFINID:ZDB-GENE-060929-248 Length:753 Species:Danio rerio

Alignment Length:848 Identity:192/849 (23%)
Similarity:305/849 (36%) Gaps:266/849 (31%)


  Fly    23 DEFETFKSLASMPADI---LQIFQKLALDLLQDLEQPVDRKGCAERSKNLREEGNLMFKESASGS 84
            :|.|.|..|..:.|..   |.:.....|::|..:.:....|...|.:...|::|||.||      
Zfish    22 EETERFSLLTDIDAIFNYGLSLICPEDLNILSRISEKFSVKKSPETASEFRQQGNLSFK------ 80

  Fly    85 SKD---SVLKACRLYSEAVFEAENAVEELSLAFANRGIALQEYGYYREAYDDCSNALECGYPERL 146
            .||   :||.    ||:.|..|:...:||||.:|||..||...|.|:...:|...:||.|||..|
Zfish    81 VKDYPAAVLH----YSKGVCHADKNTDELSLCYANRSAALFYQGLYQACLEDIRRSLEAGYPSHL 141

  Fly   147 RHKVIMRQAFCAWKLKKIASLE-EHLDYLGQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKV 210
            :.|:..||..|..:|:|..... .|.|:            ||...             |:|....
Zfish   142 QDKLQTRQTACQNQLRKAEKPNIPHTDH------------QLSPC-------------QKTVNST 181

  Fly   211 VDKSLGEILTDPGPRGRYMVAKEAISKGNVIFSERASCFVPLEQLLI-----------------C 258
            ...|.|..:.....:||:|:..|....|.|:..:.|.|.|.:...:.                 |
Zfish   182 GHLSDGVSVYFSSDKGRHMLVMENKPAGEVVLEDEAYCSVLIPANIFNTGTNKAVETFGTEDRHC 246

  Fly   259 QQCAATLMSAPIPCPNC-HQRVVYCSRKC-REAHSAIHKFECAAYRKDILRLLGISHLALRLLLT 321
            ..|.:..:|. :|||.| :.|  ||...| ::|....|::||.. ..|:|.:..:.|||||::| 
Zfish   247 HHCLSQSLSF-VPCPKCSYAR--YCGESCQKDAWDQWHQWECPV-GADLLAIGVLGHLALRVVL- 306

  Fly   322 YIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANL 386
                          ..|..|..|.:       :|..:::.:.:..|.:..::..:      |...
Zfish   307 --------------KAGQTEVQMGI-------KNTKDHVTTYKNDSPVQLSLGGD------CGKS 344

  Fly   387 LQLYLKEHTD-----FYDQFHSL--------PASIEDWQLIISALILRFAGQLLANGHVGDALLG 438
            |     :|||     .|...:||        |||    :.:::..:....|:|..          
Zfish   345 L-----DHTDCFHGSSYMGIYSLLPHVAQHSPAS----RFLMAITMAVIYGKLQG---------- 390

  Fly   439 VGMEPKEFVMLQPE----LWQKP---------RHLKRGQLHNLSHSDPITAINL----------- 479
             |..|.:::..:.|    .||..         ||:.  ||.  .::..|||:.:           
Zfish   391 -GPPPNKWMSFKDEGVKASWQPEMSMLGATALRHMM--QLR--CNAQAITAVRVKEESGMAVQSS 450

  Fly   480 ----------PYLSLCNHACEPSIRTKFD-----------GCS---------------VVNYAAK 508
                      |.|||.||:|.|:....|.           |||               |...|:|
Zfish   451 SEIRIATAIFPVLSLLNHSCSPNTSISFTTGFQPDPHNQLGCSEGHFDHPKGSRSGVTVTVRASK 515

  Fly   509 DILEGEEIFNCYTMDYRNSLKL-QRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCR 572
            |:..|:||.:||. .:|:.::: :|...|...|.|:|.|..|.| |..:.          .||.:
Zfish   516 DLTAGQEILHCYG-PHRSRMEVKERQRLLLEQYFFQCVCQACQR-DLSEG----------SPNAK 568

  Fly   573 QEFLPDAKVQQNNLRWWLRCNAEKPI-------TCT------------VCHELQHF-AWYNEFLG 617
            :...|..|.        ::|.  ||:       ||:            |.:.||.| ...:|.:.
Zfish   569 EHTAPGMKC--------VKCG--KPLQSHTDGYTCSWSSCGHQISSADVQNRLQGFQLLLDEAVH 623

  Fly   618 LIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAEELVTACFYEIDGGTSLDEFEYEDLARII 682
            |:.....:.....|..||...:..|.:.|..:..:|:.|  |..|...|..||       .|..:
Zfish   624 LMEQDRLNEALHILQSAFSQANSILTETHPFQGELADAL--ARLYASTGEWSL-------AASHL 679

  Fly   683 RKQLEGIAAQCGDNSTE-----------------------YIARMTYLWDIIAQKKCRTDRKELL 724
            ::.|..|.||.|::|.|                       .|.|...|..:....:|. :.:||.
Zfish   680 KRSLVAIQAQFGEDSIELGRQLFKLAQLHFNGRDGVASLSVIPRARRLLSLHCSPRCE-ELQELS 743

  Fly   725 EMK 727
            ||:
Zfish   744 EME 746

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 14/42 (33%)
SET <447..526 CDD:214614 32/139 (23%)
smyd4NP_001070062.1 TPR_11 68..134 CDD:290150 27/76 (36%)
TPR repeat 68..96 CDD:276809 13/38 (34%)
TPR repeat 101..134 CDD:276809 13/33 (39%)
zf-MYND 246..285 CDD:280009 14/42 (33%)
SET <456..532 CDD:214614 22/77 (29%)
T6SS_VasJ <603..679 CDD:299836 19/85 (22%)
TPR_12 615..683 CDD:290160 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56173820
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1278034at2759
OrthoFinder 1 1.000 FOG0002920
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46165
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5130
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.