DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SMYD3

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001161212.1 Gene:SMYD3 HGNCID:15513 Length:428 Species:Homo sapiens

Alignment Length:353 Identity:80/354 (23%)
Similarity:130/354 (37%) Gaps:110/354 (31%)


  Fly   216 GEILTDPGPRGRYMVAKEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPIPCPNCHQRVV 280
            ||:|....|.. |.|.|.  |:|  :..:|  |.:..|:|:.|.||                ||.
Human    27 GELLFRSDPLA-YTVCKG--SRG--VVCDR--CLLGKEKLMRCSQC----------------RVA 68

  Fly   281 -YCSRKCREAHSAIHKFECAA-------YRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAK 337
             |||.||::.....||.||..       |..|.:||||  .:..:|                   
Human    69 KYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLG--RVVFKL------------------- 112

  Fly   338 GMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFH 402
                    :...|.|||....:......:::|.:...|.|...::   ..|.:::|......|  
Human   113 --------MDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVM---TFQHFMREEIQDASQ-- 164

  Fly   403 SLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHN 467
             ||.:.:.::.....:...|.   :.|..:.:  :|||:.|.                       
Human   165 -LPPAFDLFEAFAKVICNSFT---ICNAEMQE--VGVGLYPS----------------------- 200

  Fly   468 LSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQR 532
                          :||.||:|:|:....|:|..::..|.:||..|||:..|| :|...:.: :|
Human   201 --------------ISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICY-LDMLMTSE-ER 249

  Fly   533 SHPLKAIYKFECTCAKCTRTDPDQNYLS 560
            ...|:..|.|||.|.:|...|.|.:.|:
Human   250 RKQLRDQYCFECDCFRCQTQDKDADMLT 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 13/41 (32%)
SET <447..526 CDD:214614 17/79 (22%)
SMYD3NP_001161212.1 S-adenosyl-L-methionine binding. {ECO:0000269|Ref.12} 14..16
zf-MYND 49..87 CDD:280009 17/56 (30%)
SET <201..239 CDD:279228 15/38 (39%)
S-adenosyl-L-methionine binding. {ECO:0000269|Ref.12} 205..206 1/1 (100%)
C-terminal domain, essential for histone methyltransferase activity, nuclear localization and mediates interaction with HSP90AA1. {ECO:0000269|PubMed:25738358} 272..428 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56379217
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.