DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and smyd3

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001032477.1 Gene:smyd3 ZFINID:ZDB-GENE-051120-138 Length:380 Species:Danio rerio

Alignment Length:349 Identity:76/350 (22%)
Similarity:123/350 (35%) Gaps:102/350 (29%)


  Fly   225 RGRYMVAKEAISKGNVIFSERASCFVPLEQLL--ICQQCAATLMSAPIPCPNCHQRVVYCSRKCR 287
            :|..:.|...|..|.||:|.....|......|  .||.|.....|.. .|..| :...||:.:|:
Zfish    14 KGNGLRALREIKPGEVIYSCEPFAFCVARDFLKTACQSCLKRGESLS-RCSQC-KTARYCNVQCQ 76

  Fly   288 EAHSAIHKFECAAYR-------KDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMN 345
            :.....||.||...:       .|.:||  ::.:..:||                          
Zfish    77 KQAWPDHKRECKCLKHLQPRIPTDSVRL--VARIIFKLL-------------------------- 113

  Fly   346 LSRKPEESENAPEYLRSL----RMVSQLDQAIDEELNYHILCANLLQLYL-KEHTDFYDQFHSLP 405
                 .:||:..|.|.|:    ..::.:.:...|.|.:  ||.. ||:|| :|:.|    ...||
Zfish   114 -----SQSESDQEELYSIAEHQSHLADMSEEKTEGLKH--LCTT-LQVYLAEENCD----LSRLP 166

  Fly   406 ASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSH 470
            :.::...|:.......|:   :::|.:.|  :|||:.|.                          
Zfish   167 SGLDPVSLLARVTCNCFS---ISDGELQD--VGVGLYPS-------------------------- 200

  Fly   471 SDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHP 535
                       :||.||.|:|:....|:|..:...|.:.|...||:...|| |.....|.:||..
Zfish   201 -----------MSLLNHDCQPNCIMMFEGKRLTLRAVRVIRSAEELTISYT-DILAPSKDRRSQH 253

  Fly   536 LKAIYKFECTCAKCTRTD--PDQN 557
            ...:.| |........:|  ||:|
Zfish   254 WDELLK-ESQALLHRHSDVVPDRN 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/40 (30%)
SET <447..526 CDD:214614 15/79 (19%)
smyd3NP_001032477.1 zf-MYND 49..87 CDD:280009 12/40 (30%)
SET <201..239 CDD:279228 12/38 (32%)
TPR_12 276..351 CDD:290160 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56349836
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.