DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SMYD2

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_064582.2 Gene:SMYD2 HGNCID:20982 Length:433 Species:Homo sapiens

Alignment Length:479 Identity:95/480 (20%)
Similarity:173/480 (36%) Gaps:153/480 (32%)


  Fly   213 KSLG--EILTDPGPRGRYMVAKEAISKGNVIFS-----------ERAS----CFVPLEQLLICQQ 260
            :.||  |....|| :||.:.|.:....|:::||           ||.:    ||...|.|..|.:
Human     4 EGLGGLERFCSPG-KGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGR 67

  Fly   261 CAATLMSAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPY 325
            |               ::..||:.:|::....:||.||:.                  ::.:...
Human    68 C---------------KQAFYCNVECQKEDWPMHKLECSP------------------MVVFGEN 99

  Fly   326 IRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLY 390
            ..|......:|:.:.::.::..|.|.|     :.|......|.||:..:|:       .:|:|..
Human   100 WNPSETVRLTARILAKQKIHPERTPSE-----KLLAVKEFESHLDKLDNEK-------KDLIQSD 152

  Fly   391 LKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQ 455
            :.....||.:....|.:        .:|::.|| |:..||..        :|.:|          
Human   153 IAALHHFYSKHLGFPDN--------DSLVVLFA-QVNCNGFT--------IEDEE---------- 190

  Fly   456 KPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCY 520
                        |||   :.:...|.::|.||:|.|::...:.|......|.::|..|||:|..|
Human   191 ------------LSH---LGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSY 240

  Fly   521 ------TMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDA 579
                  |.|        |:..|:..|.|.|.|.:||..|.|:..:...  :...|       |.|
Human   241 IDLLYPTED--------RNDRLRDSYFFTCECQECTTKDKDKAKVEIR--KLSDP-------PKA 288

  Fly   580 KVQQNNLRWWLRCNAEKPITCTVCHEL---QHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKW 641
            :..::.:|:          ...|..|.   :|:...:|.|.:...|     ::.:...|:|.:.:
Human   289 EAIRDMVRY----------ARNVIEEFRRAKHYKSPSELLEICELS-----QEKMSSVFEDSNVY 338

  Fly   642 LVDHHSLKRIMAEELVTACFYEID 665
            ::  |.:.:.|.     .|.|..|
Human   339 ML--HMMYQAMG-----VCLYMQD 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 8/40 (20%)
SET <447..526 CDD:214614 19/85 (22%)
SMYD2NP_064582.2 S-adenosyl-L-methionine binding 17..19 1/2 (50%)
zf-MYND 52..90 CDD:280009 12/53 (23%)
Peptide substrate binding 183..185 1/2 (50%)
SET <204..240 CDD:279228 12/36 (33%)
S-adenosyl-L-methionine binding 206..207 1/1 (100%)
S-adenosyl-L-methionine binding 258..260 1/2 (50%)
TPR_12 338..413 CDD:290160 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56430738
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.