DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and smyd2b

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001025394.1 Gene:smyd2b ZFINID:ZDB-GENE-041001-201 Length:437 Species:Danio rerio

Alignment Length:492 Identity:113/493 (23%)
Similarity:184/493 (37%) Gaps:151/493 (31%)


  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERASCFVPL--EQLLICQQCAATLMSAPIPCPNCHQRV 279
            |....|| :||.:....|...|.::||..|..:|..  |:.|||:|| .|.......|..| ::.
Zfish    11 EQFASPG-KGRGLRVSRAYGVGELLFSCPAYSYVLSVGERGLICEQC-FTRKKGLAKCGKC-KKA 72

  Fly   280 VYCSRKCREAHSAIHKFECAA-------YR-KDILRLLGISHLALRL----------LLTYIPYI 326
            .||:..|::.:..:||.||.|       :| .:.:||  ::.:..||          :|..:..:
Zfish    73 FYCNANCQKKNWPMHKLECQAMCAFGENWRPSETVRL--VARIIARLKAQKERSPSEILLLLGEM 135

  Fly   327 RPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYL 391
            ..||::|.:.|          |:..|:                          ||  |.|.|.|.
Zfish   136 EAHLEDMDNEK----------REMTEA--------------------------HI--AGLHQFYS 162

  Fly   392 KEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQK 456
            | |.||.|.               .||:..|: |:..||..        :|.:|           
Zfish   163 K-HLDFPDH---------------QALLTLFS-QVHCNGFT--------VEDEE----------- 191

  Fly   457 PRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCY- 520
                    |.||.     .|| .|.::|.||:|.|::...:.|.:....|.|||..|:||:..| 
Zfish   192 --------LSNLG-----LAI-FPDIALLNHSCSPNVIVTYRGINAEVRAVKDISPGQEIYTSYI 242

  Fly   521 TMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNN 585
            .:.|..:.:|:|   |:.:|.|.|.|.:||....|...:|. |.|.::.. .:|.....:..:|:
Zfish   243 DLLYPTADRLER---LRDMYYFSCDCKECTTKSMDVVKMSV-RKRSDEIG-EKEIKDMVRYARNS 302

  Fly   586 LRWWLRCNAEKPITCTVCHELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKR 650
            :..:.|...:|.|.|.           :..|.:...|.|.     :...|||.:.:::  |.:.:
Zfish   303 MENFRRAKQDKNILCG-----------SFILEMCELSIDK-----MSTVFDDSNVYIL--HMMYQ 349

  Fly   651 IMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQLE 687
            .|.     .|.:..|         ||...|...|.::
Zfish   350 AMG-----ICLFTED---------YEGAVRYGEKVIK 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/40 (30%)
SET <447..526 CDD:214614 21/80 (26%)
smyd2bNP_001025394.1 S-adenosyl-L-methionine binding. {ECO:0000250} 18..20 1/2 (50%)
zf-MYND 53..91 CDD:280009 12/40 (30%)
Peptide substrate binding. {ECO:0000250} 184..186 1/2 (50%)
SET <205..241 CDD:279228 13/36 (36%)
S-adenosyl-L-methionine binding. {ECO:0000250} 207..208 1/1 (100%)
S-adenosyl-L-methionine binding. {ECO:0000250} 259..261 1/2 (50%)
TPR_12 342..417 CDD:290160 8/48 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56323419
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.