DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and smyd2a

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001013568.1 Gene:smyd2a ZFINID:ZDB-GENE-050320-126 Length:435 Species:Danio rerio

Alignment Length:367 Identity:78/368 (21%)
Similarity:130/368 (35%) Gaps:129/368 (35%)


  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERASCFVPLEQLLICQ-----QCAATLMSAPIPCPNCH 276
            |....|| :||.:.|.:....|:::|:..|..:|    |.:.:     :|..|.......|..|.
Zfish    10 ERFLSPG-KGRGLKAIKHFKVGDLVFACPAYAYV----LTVNERGGRCECCFTRKEGLSKCGKCK 69

  Fly   277 QRVVYCSRKCREAHSAIHKFECAAY--------RKDILRLLGISHLALRLLLTYIPYIRPHLQEM 333
            | ..||:.:|:.....:||.||:|.        ..:.:||:.      |::|             
Zfish    70 Q-AYYCNVECQRGDWPMHKLECSAMCAYGENWCPSETVRLVA------RIIL------------- 114

  Fly   334 TSAKGMWEEIMNLSRKPEESENAP-EYLRSLR-MVSQLDQAIDE--ELNYHILCANLLQLYLKEH 394
                          ::..::|..| |.:.:|| :.:.||:..:|  |:|...:.|  |..:...|
Zfish   115 --------------KQKHQTERTPSERVLTLRELEAHLDKLDNEKNEMNDTDIAA--LHHFYSRH 163

  Fly   395 TDFYDQFHSLPASIEDWQLIISALILRFAGQLLANG---------HVGDALLGVGMEPKEFVMLQ 450
            .||.|                :|.:.....|:..||         |:|.||              
Zfish   164 LDFPD----------------NAALTELIAQVNCNGFTIEDEELSHLGSAL-------------- 198

  Fly   451 PELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEE 515
                                        .|.::|.||:|.|::...:.|......|.::|...||
Zfish   199 ----------------------------FPDVALMNHSCSPNVIVTYKGTVAEVRAVQEINPEEE 235

  Fly   516 IFNCY-TMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQ 556
            |||.| .:.|....:::|   ||..|.|.|.|.:||....|:
Zfish   236 IFNSYIDLLYPTEDRIER---LKDSYFFNCDCKECTSKSKDE 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 11/45 (24%)
SET <447..526 CDD:214614 16/80 (20%)
smyd2aNP_001013568.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19 1/2 (50%)
zf-MYND 52..90 CDD:280009 11/39 (28%)
Peptide substrate binding. {ECO:0000250} 183..185 1/2 (50%)
SET <204..240 CDD:279228 13/36 (36%)
S-adenosyl-L-methionine binding. {ECO:0000250} 206..207 1/1 (100%)
S-adenosyl-L-methionine binding. {ECO:0000250} 258..260 1/2 (50%)
TPR_12 339..412 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56402976
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.