DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and smyd5

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001107677.1 Gene:smyd5 XenbaseID:XB-GENE-988091 Length:421 Species:Xenopus tropicalis

Alignment Length:417 Identity:94/418 (22%)
Similarity:143/418 (34%) Gaps:143/418 (34%)


  Fly   225 RGRYMVAKEAISKGNVIFSER---ASCFV--PLEQLLICQQCAATLMSA---------------P 269
            :|:.:.|..||.||..||.|:   :|.|.  .|.:...|..|..:|.:|               |
 Frog    31 KGKGLFATRAIRKGETIFQEKPLVSSQFQWNALYRYRACDHCLRSLETAEENAQRLSGNAHVVLP 95

  Fly   270 IP------------CPNCHQRVVYCSRKC-REAHSAIHKFECAAYRKDILRLLGISH-------- 313
            .|            ||.|  :|.|||.:| :.|....|:..|....:|     ..:|        
 Frog    96 YPELCTVRNGLHQQCPRC--QVTYCSAECLKAAADQYHRALCLGASRD-----NPAHPLNKLEEA 153

  Fly   314 ----------LALRLLLTYIPYIRPHLQEMTSAKGMWEEIMN--LSRKPEESENAPEYLRSLRMV 366
                      .::.|:...:..|:   |.....|..|..:.:  .::...|.|.....|...:..
 Frog   154 WRNMHYPPETASIMLMARMVGTIK---QVQAQDKDWWMHLFSQFCNKTANEEEEIVHKLLGDKFK 215

  Fly   367 SQLDQAIDEELNYHILCANLLQLYLKEHTD-FYDQ----------FHSL------------PASI 408
            .||||              |.:|:    || .|::          |.||            .:|:
 Frog   216 GQLDQ--------------LRRLF----TDALYEERVSRWFTPEGFRSLFALVGTNGQGIGTSSL 262

  Fly   409 EDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKR--GQLHNLSHS 471
            ..|.                  |..|||   .:.|:|...|...:.|..:.:::  |:..|...|
 Frog   263 SQWV------------------HACDAL---ELPPREREQLDSLIDQLYKDIEKVTGEFLNCEGS 306

  Fly   472 DPITAINLPYL--SLCNHACEPSIRTKFDGCSVVNY--AAKDILEGEEIFNCYTMD--YRNSLKL 530
            .       .||  |.|||:|.|:....|...:.:.:  |.:||..||||...| :|  .|:..:.
 Frog   307 G-------LYLLQSCCNHSCVPNAEASFPDNNFILHLTALEDIQPGEEICISY-LDCCQRDRSRH 363

  Fly   531 QRSHPLKAIYKFECTCAKC--TRTDPD 555
            .|...|:..|.|.|:|.||  ...|||
 Frog   364 SRQKILRENYLFVCSCPKCLAQADDPD 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 16/68 (24%)
SET <447..526 CDD:214614 24/87 (28%)
smyd5NP_001107677.1 SET 22..>71 CDD:295368 13/40 (33%)
zf-MYND 100..135 CDD:280009 10/37 (27%)
SET <277..352 CDD:214614 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.