DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and smyd5

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001004614.2 Gene:smyd5 ZFINID:ZDB-GENE-040912-39 Length:415 Species:Danio rerio

Alignment Length:425 Identity:95/426 (22%)
Similarity:137/426 (32%) Gaps:153/426 (36%)


  Fly   225 RGRYMVAKEAISKGNVIFSER---ASCFV--PLEQLLICQQCAATLMSA---------------P 269
            :|:.:.||:...||:.||.||   :|.|:  .|.:...|:.|...|.:|               |
Zfish    31 KGKGLFAKKPFKKGDTIFIERPLVSSQFLWNALYKYRACEYCLRALETAEENARRLSGLPALILP 95

  Fly   270 IP------------CPNCHQRVVYCSRKCRE-AHSAIHKFECAAYRKDILRLLGISH-------- 313
            .|            ||.|  :|:|||.:||: |....||..|          ||.|:        
Zfish    96 HPELCKVRPDRHQACPQC--QVMYCSSECRQAAMDQYHKILC----------LGPSNDDPDHPVN 148

  Fly   314 ---------------LALRLLLTYIPYIRPHLQEMTSAKGMWEEIMN--LSRKPEESENAPEYLR 361
                           .::.:|...:..|:     .|..|..|:.:..  .||...|.|.....|.
Zfish   149 KLQDAWRSVHFPPETSSVMILAKMVATIK-----QTQDKERWQRLFTNFCSRTANEEEEIVHKLL 208

  Fly   362 SLRMVSQLDQAIDEELNYHILCANLL--QLYLKEHTDFY--DQFHSL------------PASIED 410
            ..:...||.           |..||.  .||....:.::  :.|.||            .:|:..
Zfish   209 GEKFQGQLG-----------LLRNLFTTALYEDRLSQWFTPEGFRSLFSLVGTNGQGIGTSSLSQ 262

  Fly   411 WQLIISALIL---------RFAGQLL--ANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQ 464
            |.....||.|         .|..||.  .:...||.|   ..|.....:||              
Zfish   263 WVHACDALELPRQQREQLDAFIDQLYKDIDKETGDFL---NCEGSGLFLLQ-------------- 310

  Fly   465 LHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNY--AAKDILEGEEIFNCYTMD--YR 525
                              |.|||:|.|:....|...:.:.:  |..||..||||...| :|  .|
Zfish   311 ------------------SSCNHSCVPNAEASFPENNFLLHLTALGDIGPGEEICISY-LDCCQR 356

  Fly   526 NSLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLS 560
            :..:..|...|:..|.|.|:|.||.....|.:..|
Zfish   357 DRSRHSRHKILRENYLFICSCQKCLSQMDDADMTS 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 18/68 (26%)
SET <447..526 CDD:214614 19/83 (23%)
smyd5NP_001004614.2 zf-MYND 100..135 CDD:280009 12/37 (32%)
SET <293..350 CDD:214614 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.