DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd3

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_524768.2 Gene:Smyd3 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster

Alignment Length:470 Identity:113/471 (24%)
Similarity:166/471 (35%) Gaps:159/471 (34%)


  Fly   219 LTDPGPRGRYMVAKEAISKGNVIFSERASCFVPLEQLLI--CQQC-AATLMSAPIPCPNCHQRVV 280
            |.:|.|:         |.:|..|.:|:...||...|..:  |..| .||.:   :.|.|| :.|.
  Fly    28 LKNPAPQ---------IKRGQRILTEKPFAFVLKSQYRLERCDNCLEATKV---LKCSNC-RYVS 79

  Fly   281 YCSRKCREAHSAIHKFECAAYRK-------DILRLLGISHLALRL-----LLTYIPYIRPHLQEM 333
            ||.|.|:......||.||...:|       |..|:|  ..|.|||     |      ||.:..|.
  Fly    80 YCHRSCQMQAWGQHKHECPFLKKVHPRVVPDAARML--CRLILRLEHGGDL------IRGYYTEH 136

  Fly   334 TSAKGMWEEIMNLSRKPEESENAP---EYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHT 395
            .|.|     ..:|.....|.:|.|   |:|.||                              |.
  Fly   137 GSRK-----FRDLMSHYAEIKNDPMRLEHLDSL------------------------------HA 166

  Fly   396 DFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHL 460
            ...|.....|:::.:     ...::...|:|:.||               |.:|..|:       
  Fly   167 VLTDMMAESPSTVPN-----KTELMSIYGRLITNG---------------FNILDAEM------- 204

  Fly   461 KRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDI--LEGEEIFNCYTMD 523
                      :...|||.|. :|:.:|:|:|:....|:|..:..:|.:|:  |:..:||..| :|
  Fly   205 ----------NSIATAIYLG-VSITDHSCQPNAVATFEGNELHVHAIEDMECLDWSKIFISY-ID 257

  Fly   524 YRNSLKLQRSHPLKAIYKFECTCAKCTRTD----------PDQNY---LSFHRYRCEKPNCRQEF 575
            ..|:.: ||...||..|.|.|.|:|||...          |::|.   :|..|..|  |.|....
  Fly   258 LLNTPE-QRRLDLKEHYYFLCVCSKCTDAKESKEMLAALCPNRNCGAGISVDRNNC--PRCDAGI 319

  Fly   576 LPDAKVQQNNLRWWLRCNAE--KPI----TCTVC--------HELQHFAWYNEFLGLIGSSADSS 626
            .|..:...|......|.|.|  |.:    .|.||        |.|.  .||.:.|          
  Fly   320 SPKLRNAFNEAMTLTRHNLENMKDVAYLDVCKVCLDKQTGVFHPLN--VWYVKTL---------- 372

  Fly   627 KRQALFKAFDDLDKW 641
              .|.|:|..::.||
  Fly   373 --DAAFEAAIEVGKW 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 15/41 (37%)
SET <447..526 CDD:214614 19/81 (23%)
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 15/41 (37%)
TPR_12 377..440 CDD:290160 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5081667
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.