DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and CG18213

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_650589.2 Gene:CG18213 FlyBaseID:FBgn0038470 Length:879 Species:Drosophila melanogaster

Alignment Length:956 Identity:171/957 (18%)
Similarity:318/957 (33%) Gaps:322/957 (34%)


  Fly    10 QQNELITLNENYKDEFETFKSLASMPADI------LQIFQKLALDLLQDLEQPVDRKGCAERSK- 67
            :.:|.||::|            |..|.::      |:|.:|....:..|..:..:  ||...|| 
  Fly    15 EASEYITMSE------------AMCPRNLIECELFLKILRKTTDKVFLDFSEVAE--GCLNISKK 65

  Fly    68 --NLREEGNLMF-----------KESASGSSKDSVL-------------KACR--LYSEAVFEAE 104
              |::....|..           ..|||.:..|:::             .||.  ||.|::..|.
  Fly    66 CMNMKSPTVLKMTLQSLDEIICRAPSASPTCVDAIMARSVLYIKNNQNTTACNDLLYYESLDPAL 130

  Fly   105 NAVEELSLA--------FANRGIALQEYGYYREAYDDCSNALECGYPERLRHKVIMRQAFCAWKL 161
            ...|...::        |.||     ||...::........:|.|                    
  Fly   131 KTAEGTIISQILHCICLFVNR-----EYEASKDKLSVVKGLIEDG-------------------- 170

  Fly   162 KKIASLEEHLDYLGQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEILTDPGPRG 226
                :|.:..:....|.|.|..|:::...:..:|..|    :.:|:..|..|........|....
  Fly   171 ----TLADRSEVSPFLALIEQHEERINQARINVEFCK----KVQTENFVPFKGFKLTRKIPFASQ 227

  Fly   227 RYMVAKEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPI--------------PCPNCHQ 277
            ....::::|.|...:|   |||.||..::::.:.......|||.              .|.||..
  Fly   228 ACDYSEKSIEKSGGVF---ASCDVPKGEIVLVENPVYFQFSAPFLNCELCGVHQQQLYTCDNCRY 289

  Fly   278 RVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQE-------MTS 335
            | .|||:.|.::.:.:|::||..|:..::.:|. :::..||......||.|.:.:       :::
  Fly   290 R-SYCSKSCMKSDAEVHQYECYGYKIGLIPMLE-ANMLFRLFCEAGEYILPAIVDYAMDGGILSN 352

  Fly   336 AKGMWEEIMNLSRKPEESEN--------APEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLK 392
            .:..|..|:..:::.|::.|        ||:|....|          |:....:..|..|.:::.
  Fly   353 PRDAWTFILEHAQEEEKTYNLVGELLATAPDYNLLTR----------EKYTEIVTTAFRLSVFIY 407

  Fly   393 EHTDFYDQFHSLPASIE-DWQLIISALILRFAGQLLAN-----------------GHVGDALLGV 439
            ..|...:::..|.|.:: |...:::|::||..|.:|.|                 ....|.....
  Fly   408 NDTRLAEKYFYLLALVKTDLITVMAAILLRLGGHVLLNSQRDNLCYRQREGIDAMNENNDEFENC 472

  Fly   440 GMEP-------------------KEFV-----------MLQPELWQK-----PRHLKRGQLHNL- 468
            |:.|                   .:||           .::||..:|     |......:||:: 
  Fly   473 GILPMPTDRISANVFSYYGVNAITDFVDCYNNVHDSLAEIEPEYPEKFSNDSPIFRFADRLHSIC 537

  Fly   469 -------SHSDPITAINLP------YLSLCN-----------------------HACEPSIRTKF 497
                   :..|.::|..||      .|.:.|                       |..|.:::.|.
  Fly   538 MQKYEIEAVEDLVSADTLPEQEINEILQIFNTSQRCQLLTNIAKYFQQFVYQYFHKIENTVQLKS 602

  Fly   498 DGC-----------------------SVVNYAAKDILEGEEIFNCYTM----DYRNSLKLQRSHP 535
            ..|                       .||...||.:.:|||:..|...    |....|.|.|   
  Fly   603 TLCVTLKAFKQNCGTKNIKAIFLPNGKVVGVTAKKVHKGEELVICPDFARYRDQSRILDLAR--- 664

  Fly   536 LKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAK----VQQNNLRWWL--RCNA 594
             :..:.|.        |..:..|.:..:    .|:  .||:...|    ..:.||..|:  |.:.
  Fly   665 -RGDFNFS--------TSIENEYENLEK----MPS--PEFVRHNKAFIAAIKKNLSAWIESRLDV 714

  Fly   595 EKPITCTVCHELQHFAWYNEFLGLIGSSADSSKRQAL--FKAFDDLDKWLVDHHSLKRIMAEELV 657
            ...:..|:.     :..||.||.|.....|.::...:  |..|..|:.:|  .||...|:.    
  Fly   715 NLQLNLTIL-----YGTYNSFLALHCEEKDETRFLGVLKFSMFLALNGFL--QHSTDNIVH---- 768

  Fly   658 TACFYEIDGGTSLDEFEYEDL---------ARIIRKQLEGIAAQCGDNSTEYIARMTYLWDIIAQ 713
               |.|:   |..|:..::::         .|.|.:|...|...|.:..:|| .:|..:......
  Fly   769 ---FVEL---TETDDIHFKNIEIYRQSLCVIRCIIEQYINIMVNCPEVDSEY-PKMVLVSSSFIL 826

  Fly   714 KKCRTDRKELLEMKGKVDYLASEHREVFLNY----------YNDFI 749
            |:.:...:.|::.:        |...:::.|          :|.|:
  Fly   827 KRLQIHAEALIDNE--------EASSLYMEYCTHHYKWKTVFNSFL 864

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 13/54 (24%)
SET <447..526 CDD:214614 26/159 (16%)
CG18213NP_650589.2 zf-MYND 271..309 CDD:280009 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5081684
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.