DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SmydA-2

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_649084.1 Gene:SmydA-2 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster

Alignment Length:537 Identity:111/538 (21%)
Similarity:195/538 (36%) Gaps:121/538 (22%)


  Fly   155 AFCAWKLKKIASLEEHLDYLGQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEIL 219
            |.|..|..::.:...::.|..:...||.:::......|..|:..|                 |:|
  Fly    10 ALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSECQCFEIATN-----------------EVL 57

  Fly   220 TDPGPRGRYMVAKEAISKGNVIFSERASCFVP-LEQLLICQQCAATLMSAPIP------CPNCHQ 277
                  ||::.|...|..|..|..|......| :....:|..|...|::...|      |.:|..
  Fly    58 ------GRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCSW 116

  Fly   278 RVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEE 342
            .:  |.::|.:  |..||.||        :|:..|:...:  :.|:|. ....:|......|...
  Fly   117 PL--CGKECED--SVHHKAEC--------QLMSGSNFQSK--INYVPG-EEERKESAYCVIMLLR 166

  Fly   343 IMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPAS 407
            .|:|..|..::     :|:...:...|.:.::..| |.:|.|||:            .|......
  Fly   167 CMHLKDKDPDA-----FLKLYNLEDHLKERLETPL-YQVLRANLI------------TFIKTVLG 213

  Fly   408 IEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSD 472
            ::||.   ...|||.|..|..|               .|.:.||...:|.|.|            
  Fly   214 MKDWP---EMDILRIAAILDTN---------------TFEVRQPRERRKIRAL------------ 248

  Fly   473 PITAINLPYLSLCNHACEPSIRTKF-DGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHPL 536
                  .|..::.:|.|.|::|.:| |..::|..|.:.|.:||.:...||...|::  :||...|
  Fly   249 ------YPGAAMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQPLRST--IQRRVHL 305

  Fly   537 KAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLR-CNAEKPITC 600
            :....|:|:||:|  .||::.........|.|  |:...:.......|:..|..: ||.::....
  Fly   306 RQAKCFDCSCARC--QDPEELGSFAGAQTCLK--CKAGKIISLNPLLNSAPWKCQLCNFKRSAKD 366

  Fly   601 TVCH--ELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAEELVTACFYE 663
            .|..  |||      :.|..:..:...:..:.:::...||      |.:...|:..:......|.
  Fly   367 VVTSDAELQ------QELESLDKTTPVALEEFIYRHRADL------HETNTHILQAKYALTQLYG 419

  Fly   664 IDGGTSLDEFEYEDLAR 680
            ...|.:::|...|.|.|
  Fly   420 SAPGFAMEELSGESLNR 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/46 (26%)
SET <447..526 CDD:214614 20/80 (25%)
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 6/36 (17%)
SET <246..291 CDD:214614 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.