DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SmydA-6

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster

Alignment Length:546 Identity:112/547 (20%)
Similarity:195/547 (36%) Gaps:150/547 (27%)


  Fly   226 GRYMVAKEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPIPCPNCHQRVVYCSRKCREAH 290
            ||:.||...:..|..:..|.....:||.....|.:|.....|             :| ||||.. 
  Fly    21 GRFAVALCNVRAGETLLLENPIVVLPLMGERRCSKCFNLTES-------------FC-RKCRLL- 70

  Fly   291 SAIHKFECAAY-RKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESE 354
             |:.: :|:.: .:|..|                      |.||..:    ::.:.|.:|.|.:|
  Fly    71 -ALCE-DCSDHDERDCKR----------------------LAEMNFS----DDQVELLQKKEHTE 107

  Fly   355 NAP-----------EYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASI 408
            ..|           |.|.....:||:|.                ||..:..|:.:..:.....:.
  Fly   108 IQPVLKCLLLREHEETLPLYEEMSQMDS----------------QLMTRRGTEVWKNYQEHAFTP 156

  Fly   409 EDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDP 473
            .|:..:::.  ||.|    |:..:...|||: ::...:.:..||:....|.|.|           
  Fly   157 LDYGGVLAQ--LRGA----ADEDLVQGLLGI-LDINAYEIRAPEVGGAMRGLYR----------- 203

  Fly   474 ITAINLPYLSLCNHACEPSIRTKFDGCSVVN-YAAKDILEGEEIFNCYTMDYRNSL--KLQRSHP 535
                   ...|..|:|.|::....|....:. ||.:.|..||.::||||    |.|  ..:|...
  Fly   204 -------RAGLFAHSCTPNLVISIDDEQRIKVYANRFIAAGEILYNCYT----NVLLGTEERRKI 257

  Fly   536 LKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFL---PDAKVQQNNLRWWLRCNAEKP 597
            ||....|:|:|.:|  .||.:.......:.|.:.:|...::   ||..:      |....|.|  
  Fly   258 LKVGKCFDCSCPRC--QDPTELGTHMSSFICSQCSCVDGYIVRQPDTGI------WQCLLNPE-- 312

  Fly   598 ITCTVCHELQHFAWYNEFLGLIGSSADSSKRQALFKAFDD----------LDKWLVDHHSLKRIM 652
                  |.|:     .||:    |:.....::.:|.|.||          |.:.|..:|.|...:
  Fly   313 ------HTLK-----QEFV----SNMLERAKEEIFHARDDIYRQELLLAKLSRLLHRNHFLMLDL 362

  Fly   653 AEELVTACFYEIDG-GTSLDEFEYEDLARIIRKQLEGIAAQCGDNSTEYIARM--TYLWDIIAQK 714
            .:.:.:.....:.. ||..::..||...|:.::.|..:..     .|..|:|:  ..|:: :|..
  Fly   363 KQNIASILRQILQNMGTRPNKKVYERKIRLCQEILLVLKV-----VTPGISRLKAIALYE-LANT 421

  Fly   715 KCRTDRKELLEMKGKVDYLASEHREV 740
            :....||...||:...:.|.:|...|
  Fly   422 QAELARKMYTEMEHSANDLLAELERV 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 9/40 (23%)
SET <447..526 CDD:214614 19/80 (24%)
SmydA-6NP_611182.1 SET <179..244 CDD:279228 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.