DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SmydA-7

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001261039.1 Gene:SmydA-7 FlyBaseID:FBgn0034182 Length:488 Species:Drosophila melanogaster

Alignment Length:560 Identity:124/561 (22%)
Similarity:188/561 (34%) Gaps:187/561 (33%)


  Fly   226 GRYMVAKEAISKGNVIFSERASCFVPLEQLLICQQ--CAATLMSAPIPCPNCHQRVVYCSRKCRE 288
            ||::||..||..|:.|..||.....|..:   |.|  ||..|..:.:.|..|  :|......|.:
  Fly    17 GRHLVASIAIEPGDTILEERPLLVAPHWE---CHQLKCAQCLQESYVICRRC--QVFPLCMDCNQ 76

  Fly   289 AHSAIHKFEC--------AAYRKDIL-RLLGISHLALRLLLTYIPYIRP----------HLQEMT 334
             |.   :|||        .|..|||| :..||..|...|||...|..:.          :|.:..
  Fly    77 -HD---EFECEFFTSGAGKALCKDILVKNFGICGLLKLLLLLENPRTKGDCQMLIDVPINLSDYR 137

  Fly   335 SAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYD 399
            ..:|||:|...|..:|.......:.|.:            :||....|.|:.:::          
  Fly   138 DGEGMWQEHEELVVRPLMESGLADVLPT------------QELTSDALHAHCIRI---------- 180

  Fly   400 QFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQ 464
            ..:|...:.:|                      ||.|.|:      ||      |          
  Fly   181 DSNSFEVTAKD----------------------GDTLKGI------FV------W---------- 201

  Fly   465 LHNLSHSDPITAINLPYLSLCNHACEPSIRTKFD-GCSVVNYAAKDILEGEEIFNCYTMDYRNSL 528
                       ...||      |.|.|:.....| ..::..|||..:..|:.|:|.||    |.|
  Fly   202 -----------GATLP------HHCVPNTVVALDEQFNMKLYAAVPLQPGDIIYNSYT----NPL 245

  Fly   529 --KLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKV----QQNNLR 587
              ..||.|.|:...:.||.|::|  .||.:........:|::  |     |...|    ....|.
  Fly   246 MGTSQRQHQLRLSRRLECICSRC--LDPTEMGTHMSSLKCKE--C-----PGFSVCEIDSNGKLG 301

  Fly   588 WWLRC-NAEKPITCTVCHELQHFAWYNEFLG--LIGSSADSSKRQALFKAFDDLDKWLVDHH--- 646
            .| || :....:|....||||      ..:|  |:.:..|....:||...:..|   |..:|   
  Fly   302 DW-RCPDCRALLTAAEVHELQ------AAVGSALVDAMGDLQVYEALLTQYGPL---LHPNHFML 356

  Fly   647 -SLKRIMAEELVTACFYEIDGGTSLDE---------FEY-EDLARIIRKQLEGIAAQCGDNSTEY 700
             .:|:.:|..|..|...     .|:|:         .|. .||..:.|..:.||:........||
  Fly   357 LDIKQNIASILRAAALM-----NSMDQPCKKLLARRVELCSDLLPVCRAVVPGISKLYAIGLFEY 416

  Fly   701 IARMTYLWDIIAQKKCRTDRKELLEMK------GKVDYLA 734
            :..:.                ||:|::      .|.:|:|
  Fly   417 LLALV----------------ELVELQFAESDLSKKEYVA 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/42 (29%)
SET <447..526 CDD:214614 16/80 (20%)
SmydA-7NP_001261039.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56387847
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.