DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SmydA-1

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_610944.1 Gene:SmydA-1 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster

Alignment Length:570 Identity:119/571 (21%)
Similarity:193/571 (34%) Gaps:181/571 (32%)


  Fly   272 CPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISH---LALRLLLTYIPYIRPH---L 330
            |.||:| |.|||.:.::....:||..|..::        |:|   |...|:.|..  |:|:   |
  Fly    15 CSNCNQ-VSYCSVQHQKQDWKVHKPSCHPFK--------IAHNEQLGRHLVATRT--IKPYEIVL 68

  Fly   331 QEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLD----------------QAIDE---- 375
            :|....:|           |.:. :||..|..|..:...|                :::||    
  Fly    69 KEAPLVRG-----------PAQI-SAPVCLGCLNGIEAEDHIECEQCGWPLCGPECKSLDEHKAE 121

  Fly   376 ---------ELNY------HIL--CANLLQLYL--KEHTDFYDQFHSLPASIEDWQLIISALILR 421
                     ::|.      |.|  |.:.::..|  :..|:...:|..| .|:|..:        |
  Fly   122 CGLTKDRGQKVNVQEFGGPHPLYTCLSTVRCLLIGETSTEKASKFQDL-ESLESTR--------R 177

  Fly   422 FAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKR------GQL----HNLSHSDPITA 476
            .:.|..|:      |:.:|    :|:   |:.::..:..:.      |.|    |.:..:||...
  Fly   178 GSNQWKAD------LVSIG----QFI---PKFFKTQKFTEEEIMKAVGALQINGHEVPTTDPSHV 229

  Fly   477 INLPYLSLCNHACEPSIRTKFD---GCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHPLKA 538
            ......|...::|.|::...|:   .|  :.:|.::|.:...:..||:.....:...||.  |..
  Fly   230 AVFYTASFTENSCLPNLAKSFNKNGHC--ILWAPREIKKNAHLSICYSDAMWGTADRQRH--LMQ 290

  Fly   539 IYKFECTCAKCTR-TDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAEKPITCTV 602
            ...|:|.|.:|.. |:.|.||.:.   :||...|....|| .|..:.|..|          .|..
  Fly   291 TKLFKCACERCVDVTELDTNYSAI---KCEDRQCGGLMLP-TKADEWNGSW----------RCRE 341

  Fly   603 CHELQHFAWYNEFLGLIGSSADSSKRQAL--FKAFDDLDKWLVDHH------------------- 646
            ||:.....:....|...|....|.::.|.  .|.....:|||...|                   
  Fly   342 CHKQVQKHYVERILERAGKDIQSMEKIAENGLKYLKHYEKWLPPQHFHMSEIKILLVQLLAKDQK 406

  Fly   647 ----------SLKRIMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQLEGIAAQCGDNSTEYI 701
                      .||...|.|||.  .||     .|...|...|..:..:....||.|     |..:
  Fly   407 ELMVIPDDRLLLKLNFARELVE--LYE-----KLTPCEVRTLGTLCFELHSAIAEQ-----TRRV 459

  Fly   702 ARMTYLWDIIAQKKCRTDRKELLEMKGKVDYLASEHREVFLNYYND-FIE 750
            |..|.|          :.:..|.|....||...:     :|.|.:| |||
  Fly   460 ALETSL----------SPKDRLEESLFYVDKCVN-----YLKYESDIFIE 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 10/26 (38%)
SET <447..526 CDD:214614 15/92 (16%)
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.