DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd4-4

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_610730.1 Gene:Smyd4-4 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster

Alignment Length:600 Identity:145/600 (24%)
Similarity:236/600 (39%) Gaps:132/600 (22%)


  Fly    17 LNENYKDEFETFKSLASMPADILQIFQKLALDLLQDLEQPVDRKGCAERSKNLREEGNLMFKESA 81
            |.||::......::|..... |.:||  |.:.|.:|        .|.:||...|..||..|    
  Fly    30 LKENHRKVDFVMRALIDFKY-IEKIF--LNVTLRED--------KCNKRSVEFRMLGNEQF---- 79

  Fly    82 SGSSKD-SVLKACRLYSEAVFEAENAVEELSLAFANRGIALQEYGYYREAYDDCSNALECGYPER 145
              |.|: :..:|..||::::..||...|.||:.:|||...|.|:..||:..|:...|.:..||.|
  Fly    80 --SLKNRNYFQALELYNKSICYAEPNSEHLSIGYANRSAVLFEWKRYRQCLDNIKLARQANYPAR 142

  Fly   146 LRHKVIMRQAFCAWKLKKIASLEEHLDYLGQLQLKESFE--QQLEDLKQKLELLKNQPREQETQG 208
            |.||:..|:..|.      ..|::....:...:.|.|||  .|:..:...|||       :||..
  Fly   143 LSHKLDKRERDCQ------QLLDQQPPDVVPYEFKLSFEPHAQVPFIADCLEL-------RETAA 194

  Fly   209 KVVDKSLGEILTDPGPRGRYMVAKEAISKGNVIFSERASCFVPLEQL--LICQQCAATLMSAPIP 271
            :                ||::|....::.|:::..|...|...|..:  :.|..|........||
  Fly   195 E----------------GRFVVTNRDLAVGDLVSVEEPFCSTLLTPMRYIRCATCKRENYLTLIP 243

  Fly   272 CPNCHQRVVYCSRKCRE-AHSAIHKFECAAYRKDIL-RLLGISH-LALRLLLTYIPYIRPHLQEM 333
            |.:|.. .::||.:|:. |....|::||...  |.| |:....| :|||..|..: .|.|.::|:
  Fly   244 CDSCCS-TMFCSEECKSIAMQTYHRYECPII--DFLNRMFNKIHCIALRTTLVAL-NIFPSIEEL 304

  Fly   334 TSAKGMWEEIMNLSR----------KPEESENAPEYL---RSLRMVSQLDQAIDEELNYHILCAN 385
            ..   ..|:..|..:          .|||...|...|   :.||.||.|.|.       .::|| 
  Fly   305 ID---FCEQEQNQDKCAFDLNYNELTPEEHYRAIHGLVTNQHLRSVSDLFQR-------SVVCA- 358

  Fly   386 LLQLYLKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQ 450
            :|:.::.|:|...:....     |:.....:.|:.|......:|.|      |:           
  Fly   359 VLKHFIIEYTPVKEYLGG-----EEGVNFFTDLLFRHLQTSPSNMH------GI----------- 401

  Fly   451 PELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEE 515
             :|.::....|..|    :||....|    :|||.||:|.|:....::|.....:..:.|..|..
  Fly   402 -DLVEQVNETKDDQ----THSSGAYA----FLSLINHSCAPNTVRIYEGTKAYMFVLRPIKAGNV 457

  Fly   516 IFNCYTMDYRNSLKLQRSHPLKAIYKFECTCAKC-----------------TRTDPDQNYLSFHR 563
            :::.|...:....|.||...|...|:|:|.|..|                 :.||..:..||.:.
  Fly   458 LYDNYGAHFAICSKEQRLKRLSLQYRFDCKCEGCELNYPMFGMMPHKATVPSVTDDTELALSSYN 522

  Fly   564 YRCEKPNCRQ--EFL 576
            |.....|.|:  :||
  Fly   523 YDFAVSNYRKYCDFL 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/41 (29%)
SET <447..526 CDD:214614 17/79 (22%)
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150 25/77 (32%)
zf-MYND 230..270 CDD:280009 12/41 (29%)
SET 363..463 CDD:279228 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6581
OrthoDB 1 1.010 D1278034at2759
OrthoFinder 1 1.000 FOG0002920
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5130
54.890

Return to query results.
Submit another query.