DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd4-3

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_725048.1 Gene:Smyd4-3 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster

Alignment Length:690 Identity:175/691 (25%)
Similarity:259/691 (37%) Gaps:177/691 (26%)


  Fly    63 AERSKNLREEGNLMFKESASGSSK-DSVLKACRLY--SEAVFEAENAVEELSLAFANRGIALQEY 124
            |.::.:|..|    .||.|:.:.| ...|:|..||  |.....:|| |.|:.:..|||...|...
  Fly    67 AGKNASLAAE----IKERATSAFKAKKWLEAMMLYTRSYVALPSEN-VAEIRVVLANRSATLYHM 126

  Fly   125 GYYREAYDDCSNALECGYPERLRHKVIMRQAFCAWKLK----KIASLEEHLDYLGQLQLKESFEQ 185
            ..|:|...|...||:..|.:.|.:|:..|||.|...||    .|.|.::.:..:....|......
  Fly   127 QKYQECLIDIKRALDLSYSKDLIYKLYERQARCYMALKDYPHTIDSFKKCITAMDDSTLASDKRA 191

  Fly   186 QLE-DLKQKLELLKNQPR------EQETQGKVVDKS----LGEILTDPGPR-------GRYMVAK 232
            :|. |....:::|:|.||      :|:.|...:|::    |......|..|       ||:..|.
  Fly   192 KLNLDAMTMIKMLQNDPRTAKQEAKQQKQKIALDQAKPVKLENEFVSPLVRIDSNRQEGRFARAS 256

  Fly   233 EAISKGNVIFSERASCFVPLEQL--LICQQCAATLMSAPIPCPNCHQRVVYCSRKCR-EAHSAIH 294
            ..:..|..:..||....|.||:.  ..|:.|....: .|:.||.|.. |:|||.:|| ||....|
  Fly   257 ADVKPGEELLVERPFVSVLLEKFAKTHCENCFMRTV-VPVACPRCAD-VLYCSEQCREEASKKYH 319

  Fly   295 KFECAAYRKDILRLLGIS---HLALRLL----LTYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEE 352
            |:||...  .|:...|.|   |:|||::    |.|...::|.:.|                    
  Fly   320 KYECGIV--PIIWRSGASINNHIALRIIASKPLDYFLKLKPTIDE-------------------- 362

  Fly   353 SENAPEYLRSL-----RMVSQLD--QAIDEELNY--HILCANLLQLYLKEHTDFYDQFHSLPASI 408
             |..||.|.||     |.|:||:  |...:..|:  |:|.|..|...|:..    ..|.|.|.  
  Fly   363 -ELTPEQLISLPKDDFRRVAQLERHQGERQPSNFFQHVLMARFLTNCLRAG----GYFGSEPK-- 420

  Fly   409 EDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDP 473
            .|...||.:|:||....:..|.|                             :..:||..|.|..
  Fly   421 PDEVSIICSLVLRSLQFIQFNTH-----------------------------EVAELHKFSSSGR 456

  Fly   474 ITAINL-----PYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRS 533
            ..:|.:     |.|:|.||:|:|.:...|.|.::...:.:.|..|..|...|...|....:.:|.
  Fly   457 EKSIFIGGAIYPTLALFNHSCDPGVVRYFRGTTIHINSVRPIEAGLPINENYGPMYTQDERSERQ 521

  Fly   534 HPLKAIYKFECTCAKCTRTDPDQNYLSFH-------RYRCEKPNCRQEFLPDAKVQQNNLRWWLR 591
            ..||.:|.|||:|..|.     .|:..|.       |:||:.||                    .
  Fly   522 ARLKDLYWFECSCDACI-----DNWPKFDDLPRDVIRFRCDAPN--------------------N 561

  Fly   592 CNA--EKP-------ITCTVCHELQHFAWYNEFLGL-IGSSADSSKRQA--LFKAFDDLDKWLVD 644
            |:|  |.|       :.|..|.|:.     |...|| :....:...|.|  |::. .:..|.|..
  Fly   562 CSAVIEVPPSCNDFMVKCVTCGEIT-----NILKGLKVMQDTEMMTRTAKRLYET-GEYPKALAK 620

  Fly   645 HHSLKRIMAEEL-------------VTACFYEIDGGTSLD 671
            ...|.|||.|.|             :..||..:....:||
  Fly   621 FVDLIRIMYEVLAPPFPDFCESQQHLKDCFLNLGNVYTLD 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 17/41 (41%)
SET <447..526 CDD:214614 19/84 (23%)
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150 23/74 (31%)
TPR repeat 74..103 CDD:276809 10/33 (30%)
TPR repeat 108..142 CDD:276809 12/35 (34%)
TPR repeat 150..177 CDD:276809 9/27 (33%)
zf-MYND 284..323 CDD:280009 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6581
OrthoDB 1 1.010 D1278034at2759
OrthoFinder 1 1.000 FOG0002920
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46165
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5130
65.990

Return to query results.
Submit another query.