DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SmydA-5

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_610202.3 Gene:SmydA-5 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster

Alignment Length:529 Identity:102/530 (19%)
Similarity:156/530 (29%) Gaps:221/530 (42%)


  Fly   226 GRYMVAKEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPIPCPNC--------HQ----R 278
            |||:...:.|:.|.::|.|......|...|....:.|:.     :||..|        ||    |
  Fly    55 GRYLKVTQNIAAGQIVFIEEPLVVGPKWYLSDADKEASN-----VPCVGCYTPCRLGKHQCRRCR 114

  Fly   279 VVYCSRKCREAHSAIHKFECAAY--------RKDILRL----LGISHLALRLLLTYIPYIRPHLQ 331
            ...||..|:  |.::   ||:..        |.|...|    .|.:.|.|:.||         ||
  Fly   115 WPVCSAGCK--HESM---ECSVLSLGSGSPTRADARSLNDYFRGDALLVLKCLL---------LQ 165

  Fly   332 EMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTD 396
            ..:..|  |..::.:....||                                       ::.||
  Fly   166 RQSPTK--WSALLEMQSHEEE---------------------------------------RKGTD 189

  Fly   397 FYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLK 461
            .|:         |..:.:::.|..||..:|...            .|.......||:        
  Fly   190 LYE---------EAEKRVVTYLQKRFLCRLKQT------------NPNLLTDCGPEM-------- 225

  Fly   462 RGQLHNLSH--SDPITAINLP--------YLSLC--NHACEPSIRTKFDGCS--VVNYAAKDILE 512
               ||.|..  ......|.||        :...|  .|||:|:...:||..:  |...|..|:.:
  Fly   226 ---LHRLCGIIETNFMVIELPSGVELSGLFRQACMMEHACQPNCDFQFDNKTQQVAVRAGCDLRK 287

  Fly   513 GEEIFNCYTMDYRNSL--KLQRSHPLKAIYKFECTCAKCTRTDPDQ--NYLSFHRYRCEKPNCRQ 573
            |:.:    .:.|.|.|  ...|.|.|:....|.|.|::|  .||.:  .|:|.            
  Fly   288 GDHL----RITYTNILWGTQLRQHHLRLTKHFSCRCSRC--LDPTEYGTYISA------------ 334

  Fly   574 EFLPDAKVQQNNLRWWLRCNAEKPITCTVCHELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDL 638
                            |.|..:...||...|                            ...|.|
  Fly   335 ----------------LTCLGDVNQTCGGTH----------------------------LPVDPL 355

  Fly   639 D---KWLVDHHSLKRIMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQLEGIAAQC-GDNSTE 699
            |   :|..|              .|...:||.      ...:|...:.:|:||:.|.| ..|..|
  Fly   356 DENTQWKCD--------------TCPMIVDGA------YVAELQSHMTEQVEGLLAGCPSANQVE 400

  Fly   700 -YIARMTYL 707
             .:||:|::
  Fly   401 LLLARLTHM 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/52 (23%)
SET <447..526 CDD:214614 20/93 (22%)
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 28/146 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5081734
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.