DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and dao

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001260462.1 Gene:dao FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster

Alignment Length:747 Identity:233/748 (31%)
Similarity:353/748 (47%) Gaps:62/748 (8%)


  Fly    42 FQKLALDLLQDLEQPVDRKGCAERSKNLREEGNLMFKESASGSSKDSVLKACRLYSEAVF--EAE 104
            |:...|...|.|..........|.|:.|||.||..:::      :...|||..|::||:|  .|.
  Fly   142 FRPHVLKWFQHLRHQTGHFKSEEESRRLREAGNDSYRK------ERHPLKASDLFTEAIFLAPAR 200

  Fly   105 NAVEELSLAFANRGIALQEYGYYREAYDDCSNALECGYPERLRHKVIMRQAFCAWKLKKIASLEE 169
            |.: ..:||.|||.:.|.:.|.|.|:||||..||:.||||.....:.:|||.||.||:..|..||
  Fly   201 NTL-AAALAHANRSLVLFDCGLYAESYDDCLCALDLGYPEEYLPLIKLRQAACALKLRNFALCEE 264

  Fly   170 HLDYLGQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEILTDPGPRGRYMVA--- 231
            ||..|..::|.:.||.:..:|..:.|:||.:..|...|       .|:.| |......:.:|   
  Fly   265 HLHELLHIELNQVFEARTHELWHQCEVLKVERFEMAVQ-------TGDDL-DINDSKAFEIAWLD 321

  Fly   232 -------KEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPIPCPNCHQR-VVYCSRKCRE 288
                   ..|::|..:||...|...||.....:|..|..| ...|.||..|..| ||||||:||.
  Fly   322 NSSSLHTTRAVAKNALIFESEAVAMVPSGNCRVCDYCGIT-QFIPFPCIYCSNRLVVYCSRQCRF 385

  Fly   289 AHSAIHKFECAAYRKDILRLLG-------ISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIM-N 345
            .|:|||..||..::.::....|       :..||.|:|:|.:|.:..|.::..:...:|..|. .
  Fly   386 KHAAIHAVECFGHQIELFESFGEVFGMPRLLQLAFRMLITGLPELLGHCRKKPTLSKLWSAINGG 450

  Fly   346 LSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFH-SLPA--- 406
            |..:.:.:.:|...|..|:.....|..|...|..||     |.:||.:.|.|:||.. |||.   
  Fly   451 LQERQDIAYSAVLRLERLKEERPTDTVIALALAAHI-----LSIYLSKCTTFFDQLEKSLPTASR 510

  Fly   407 -SIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQP-ELWQKPRHLKRGQLHNLS 469
             |..:|:|:.:||::|..|||............:..:|..|..|.. :||..|..|:.|.||.|:
  Fly   511 MSSAEWELLCAALLMRHIGQLRHRSLTACRSFVLPADPHVFSPLNEFQLWAAPMRLQEGHLHLLA 575

  Fly   470 HSDPITAINL--PYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQR 532
            ....:.:.::  ..|:||.|:|..:|..||.|.:|...|..|:..|..|:||:...  |..:|.|
  Fly   576 GEVAVVSYSVYPDTLNLCRHSCSSTICAKFSGRTVTALALLDLPAGSGIYNCFAGG--NFQQLPR 638

  Fly   533 SHPLKAIYK--FECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAE 595
            ....|.:.:  ..|.|..|..|..|..:..||||||:.|||.:.|.|:|.....:|||||.....
  Fly   639 EERTKQLLESGIRCHCNACQLTHSDDQFHKFHRYRCDNPNCMEIFTPNALPHAPSLRWWLSEEYT 703

  Fly   596 KP-------ITCTVCHELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMA 653
            :|       |.|..|.|.|...|:..|...:.......:|..|:.|.:..:..|:|.|..|..:|
  Fly   704 QPEFNGADLIMCPHCGEYQKLEWFWAFTTSLIDCELIEERCKLYAAIERAENQLMDLHECKVALA 768

  Fly   654 EELVTAC-FYEIDGGTSLDEFEYEDLARIIRKQLEGIAAQCGDNSTEYIARMTYLWDIIAQKKCR 717
            ..|:..| ....:|.|.||::|:..|..|:|..|..:.||.|..|.||:...:|.||::|....:
  Fly   769 RLLLEQCLMVHREGATVLDDWEFNKLGSILRSVLPSVMAQYGGQSIEYVKYFSYFWDVMALSNYK 833

  Fly   718 TDRKELLEMKGKVDYLASEHREVFLNYYNDFI 749
            .:.:||::|...::::|.|.:::|:|||.|:|
  Fly   834 CNDRELMQMLNALEFIADEFKDIFINYYEDYI 865

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 21/41 (51%)
SET <447..526 CDD:214614 25/82 (30%)
daoNP_001260462.1 TPR_11 165..235 CDD:290150 30/77 (39%)
TPR repeat 200..235 CDD:276809 16/36 (44%)
TPR repeat 243..270 CDD:276809 13/27 (48%)
zf-MYND 355..395 CDD:280009 21/41 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5081660
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I1655
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1278034at2759
OrthoFinder 1 1.000 FOG0002920
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46165
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.