DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SmydA-3

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster

Alignment Length:517 Identity:96/518 (19%)
Similarity:164/518 (32%) Gaps:182/518 (35%)


  Fly   226 GRYMVAKEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPIPCPNCHQ------------- 277
            |||:|||.||....::..|......|        :|     :.|:.|..|::             
  Fly    21 GRYLVAKGAIRGHGLLIEELPFAVGP--------KC-----NGPVVCLGCYEPNPDPEEELCSEC 72

  Fly   278 ---RVVYCSRKCREAHSAIHKFECAAYRKDILRLL----GISH-------LALRLLLTYIPYIRP 328
               ..|.|:::...||   .:.||:..:....|..    |..|       :.||:||.       
  Fly    73 GWPLCVECAQQADNAH---FRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLLA------- 127

  Fly   329 HLQEMTSAKGMWE-EIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLK 392
              :|....:  |: |:..:....||.:.                  |.:: :|....|:.| ||:
  Fly   128 --KEANPER--WDNEVAPMEHHKEERQR------------------DADV-WHADRVNIAQ-YLR 168

  Fly   393 EHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKP 457
            ......::|.             ..||::..|.|..|..       ....||.:           
  Fly   169 GPCQLANRFS-------------EELIMQVVGVLEVNAF-------EARSPKGY----------- 202

  Fly   458 RHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKF---DGCSVVNYAAKDILEGEEIFNC 519
                           |:..: .||..:..|.|.|:.....   :|..:...|..|:.||:.:.:.
  Fly   203 ---------------PLRCL-FPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHS 251

  Fly   520 YTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQN 584
            ||  |......||...||....|.|.|.:|  .||.:....|...:|.:  |.:.|....:..:.
  Fly   252 YT--YTLDGTAQRQKHLKQGKFFTCQCERC--LDPTELGTHFSSLKCGQ--CAEGFQVPRQPTEP 310

  Fly   585 NLRWWLRCNAEKPITCTVCHELQHFAWYNEFLGLIGSSADS-----------SKRQAL---FKAF 635
            :..|          .|..|             |...|:||:           :..|||   .|..
  Fly   311 DTSW----------NCANC-------------GSDTSNADALAMLQSLQSEVNAVQALPMAAKRL 352

  Fly   636 DDLDKWLVDHHS-----------LKRIMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQL 686
            :::::.|..:.|           |::::.|.......||:   ..|.:.:.|..|.:.|:.|
  Fly   353 EEIERLLRKYKSLLHPLHFIATGLRQLLIEMYGRVQGYEM---VQLPDHQLERKAELCRQVL 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 9/56 (16%)
SET <447..526 CDD:214614 14/82 (17%)
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 10/46 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.